KEGG   Anabaena variabilis: Ava_B0243Help
Entry
Ava_B0243         CDS       T00277                                 

Definition
helicase RecD/TraA (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ava  Anabaena variabilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ava00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ava_B0243
Enzymes [BR:ava01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ava_B0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
A:274535..276784
Genome map
AA seq 749 aa AA seqDB search
MSTLPTAQQTEAQPHYEIITGVVERLTFHSEESGYTVARLTRSRSTDLTTIVGSFANIQP
GQTLQLTGFWKDHPQYGPQFNVTNYHETKPATLTGIEKYLGSGLIKGVGPVTARRIVAHF
GLETLDIIENQIDRLIEVQGIAKKRIKLIKNAWETQKAIKEVMVFLQTHGVSTTYAVKIY
KQYQDKAIATVTANPYQLATDIYGIGFLTADKIARNLGVPSSSEFRYSAGIIHALSEAAE
DGHCYLPQPELIEKVIKLLTTDDHQPTNEAIADIIKDMSAKEELIREYVRDSYGEKLLLC
YKPSFFHTEQNLAQLISRRLRQQVKQDIPRVRAWLERFMSSRKIQLSPQQQQAVEKAAYS
PVMVLTGGPGVGKTFTTHTIVSLWKAMGKNIALAAPTGRAAQRLSEMTGLEAKTIHRLLE
FDPKTMGFKRDNENPLPFSAIIADEASMLDLFLAHSLFKAVANGAQLLLVGDIDQLPSVG
PGKVLADLITSLQVPVVKLTQVFRQAQQSAIVTAAHQINQGDYPKIEPISDNPQSDCLWH
GGGHSPEHGVQAICELVGEFIPRLGFNPGTDVQVLSPMSRGLVGTRNLNAVLQQLINPPA
SGKVEISRGGMILREGDRVIQQMNDYDREVFNGDLGTILNIDTEEQEVTVEYGGRAVVYD
YADLNEITLAFAISCHKSQGGEFPVVIFPLFMQHYVMLSRNLFYTGLTRARKLAIVVGSK
KAITLAVRTTNDQQRYTRLWQRLLQPMAL
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactctaccaacagcacaacaaaccgaagcacaaccccactacgaaatcatcacc
ggagtagtcgagcgcctaacgttccactcagaggaatccgggtatacagtcgcacgtcta
acccgctcccgcagtaccgacctcaccaccatcgtcggcagcttcgctaacatccagcct
gggcaaacgctacagctaacaggcttctggaaagaccatccgcagtacgggccacaattc
aatgtcactaactaccacgaaaccaaacccgctaccctcaccggaatcgagaaatacctg
ggtagcggactaatcaaaggagtcgggccggtcacagcaaggcgcattgttgcacatttc
gggttagaaacactcgacatcattgagaaccaaattgaccgcctaattgaagtacaaggt
atcgccaagaaacgcatcaagctcatcaagaacgcctgggaaacgcaaaaggcaatcaaa
gaggtgatggtgttcttgcaaacccacggcgtttctacaacatacgccgtaaaaatatat
aaacaataccaagataaagcgatcgccaccgtcactgcgaacccgtaccagcttgcgacc
gacatctacggtattggcttcttgaccgccgacaagattgcgcgaaatcttggtgtaccc
tcaagctcagaatttcgttacagcgctggcattatccacgcattgagtgaagcagccgaa
gatggtcattgttatctcccccagccggaactcatcgagaaagttatcaagctactaaca
accgatgaccatcagccaacaaatgaagcgatcgcggacatcatcaaagatatgtcagcc
aaggaagaactcatccgggaatatgttagagacagctacggagaaaagttattgctgtgc
tataagccgagcttcttccacaccgagcagaatttagcacagttgatatctcgacggtta
cgccaacaagttaaacaagatattccccgcgtccgtgcttggctagagcgattcatgtcc
agccgcaaaattcagctatcaccccaacagcagcaagcggtagagaaggcagcttactct
ccggtaatggttcttactggtgggccaggggtggggaaaaccttcacgacacacaccata
gtttcattgtggaaagcgatgggaaaaaacattgccctagctgcaccaacaggaagggcc
gcacagcgattatccgagatgactgggctggaagctaagaccattcaccgcttgctggaa
tttgacccgaaaacaatgggtttcaaacgggataacgaaaatcccctgcccttcagtgcc
attattgccgatgaggcttcgatgttagacctatttctggcacattcgctctttaaagcg
gtagctaatggagcgcaactattattagtgggtgatattgaccaattaccatcagtaggc
cctggtaaagtgctggcagacctaatcacttcactacaagtaccagtggtgaagctaacg
caagtatttcgccaagcccagcaaagcgcaattgtgacggcagcgcaccaaatcaaccag
ggggattacccaaagattgaaccaatcagcgataatccgcagtcggactgcttgtggcat
ggtggtggccacagccctgaacacggagtccaagcaatctgtgaattggtaggcgagttt
atcccacggctgggttttaatccaggcacggatgtacaggtgttgtctccaatgtcgcgg
gggttagtcgggactagaaatttgaatgccgttttgcagcagctgatcaatccgcctgca
tcggggaaagtcgagattagccggggtgggatgattctgcgcgagggcgatcgcgttata
caacagatgaatgattatgaccgcgaggtctttaacggggatttggggactattttaaat
attgatacggaggagcaagaggttacggttgagtatggtggtcgggctgtggtgtatgat
tatgcggatctcaatgagataactttggcatttgcgatttcatgtcataaaagccagggc
ggagagtttccagttgtaatatttccacttttcatgcaacattatgtcatgctttcgcgg
aatttgttttatacaggtctgaccagggcaaggaagttagcgattgtggttggttccaag
aaggcgatcaccttggcagtcagaactacgaatgatcagcagcgctacactcggttgtgg
cagaggttgttgcagccgatggctttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system