KEGG   Trichormus variabilis: Ava_C0116Help
Entry
Ava_C0116         CDS       T00277                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_24 HTH_40 HTH_23 HTH_28 HTH_38 EutK_C HTH_29 HTH_20 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ABA25204
JGI: AvaC0116
CyanoBase: Ava_C0116
CYORF: Ava_C0116
UniProt: Q3M1D9
Position
C:complement(138276..138905)
Genome map
AA seq 209 aa AA seqDB search
MSQATTIRVLIADDHAIFRQGLATIINRDPEMQVIAQAENGEQAIAAFREHQPDVTLMDL
RMPEVEGVAAIGAICATAKSARIIVLTTYDSDEDIYRGLQAGAKGYLLKETEPDELLNAI
RTVHRGQKYIPPDVGAKLVQRLSNPELSERELAVLRSLAQGMSNAEIAAALSIGEGTVKS
HVNRILNKLDVSDRTQAVIVAVKRGIVSL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagctacgaccattcgggttctaattgcggacgatcacgccatttttcggcaa
ggattagccacgattattaaccgtgacccagagatgcaggtgattgcacaagccgaaaat
ggggaacaagcgatcgccgcctttcgagaacaccaaccagatgtaacgctaatggatctg
cgaatgcctgaagtggaaggagttgccgccattggtgcaatttgtgctactgctaaatct
gctcggattattgtactgaccacgtatgatagtgacgaagatatttatcggggattgcag
gcaggcgcaaaaggatacctgttgaaagaaactgaaccggacgagcttctgaatgcgatt
cgtaccgttcatcggggccagaagtatattccgcccgatgtgggagcaaagttggtacag
cgcctcagcaatccagaactgagtgaaagagaactagcagtactccgctcactggcgcag
ggaatgagtaatgccgagattgcggcggctttgagtatcggtgaaggcactgttaaatcc
catgtcaatcggattttgaataagttggatgtaagcgatcgcacccaagctgtgattgtt
gccgttaagcgcggcattgtaagtttgtag

DBGET integrated database retrieval system