KEGG   Anabaena variabilis: Ava_C0116Help
Entry
Ava_C0116         CDS       T00277                                 

Definition
two component LuxR family transcriptional regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
ava  Anabaena variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
C:complement(138276..138905)
Genome map
AA seq 209 aa AA seqDB search
MSQATTIRVLIADDHAIFRQGLATIINRDPEMQVIAQAENGEQAIAAFREHQPDVTLMDL
RMPEVEGVAAIGAICATAKSARIIVLTTYDSDEDIYRGLQAGAKGYLLKETEPDELLNAI
RTVHRGQKYIPPDVGAKLVQRLSNPELSERELAVLRSLAQGMSNAEIAAALSIGEGTVKS
HVNRILNKLDVSDRTQAVIVAVKRGIVSL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagctacgaccattcgggttctaattgcggacgatcacgccatttttcggcaa
ggattagccacgattattaaccgtgacccagagatgcaggtgattgcacaagccgaaaat
ggggaacaagcgatcgccgcctttcgagaacaccaaccagatgtaacgctaatggatctg
cgaatgcctgaagtggaaggagttgccgccattggtgcaatttgtgctactgctaaatct
gctcggattattgtactgaccacgtatgatagtgacgaagatatttatcggggattgcag
gcaggcgcaaaaggatacctgttgaaagaaactgaaccggacgagcttctgaatgcgatt
cgtaccgttcatcggggccagaagtatattccgcccgatgtgggagcaaagttggtacag
cgcctcagcaatccagaactgagtgaaagagaactagcagtactccgctcactggcgcag
ggaatgagtaatgccgagattgcggcggctttgagtatcggtgaaggcactgttaaatcc
catgtcaatcggattttgaataagttggatgtaagcgatcgcacccaagctgtgattgtt
gccgttaagcgcggcattgtaagtttgtag

DBGET integrated database retrieval system