KEGG   Azotobacter vinelandii CA6: AvCA6_42130Help
Entry
AvCA6_42130       CDS       T02634                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
avd  Azotobacter vinelandii CA6
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:avd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AvCA6_42130
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA6_42130
   00650 Butanoate metabolism
    AvCA6_42130
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AvCA6_42130
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA6_42130
   00622 Xylene degradation
    AvCA6_42130
   00621 Dioxin degradation
    AvCA6_42130
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AvCA6_42130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4241622..4242560)
Genome map
AA seq 312 aa AA seqDB search
MTKKLKVAIVGSGNIGTDLMIKILRHGQHLEMGALVGIDPNSDGLARAARLGVATTAEGV
EGLARLPGFGEIDFVFDATSAGAHVRNEAFLRALKPGLRLIDLTPAAIGPYCVPVVNLEQ
NLHETNVNMVTCGGQATIPMVAAVSRVARVHYAEIVASIASRSAGPGTRANIDEFTETTS
KAIEAIGGARKGKAIIVLNPAEPPLIMRDTVYVLSAPADRARVEASLAEMAQAVQGYVPG
YRLKQRVQFDEIPDAAPLNIPGLGRLSGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAALA
TAERMAQSMLNA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaactcaaagtcgccatcgtcggctccggcaacatcggcaccgacctgatg
atcaagatcctgcgccacggccagcacctggaaatgggcgccctggtcggcatcgacccg
aattccgacggcctggcccgcgccgcgcgcctcggcgtggccaccaccgccgagggcgtc
gagggcctggcccgcctgccggggttcggcgagatcgacttcgtcttcgacgccacttcg
gccggcgcccatgtgcgaaacgaggccttcctgcgcgcgctcaagcccggcctgcggctg
atcgacctgaccccggcggccatcggcccctactgcgtgccggtggtgaatctggagcag
aacctccacgaaaccaacgtcaacatggtcacctgcggcggccaggcgaccatccccatg
gtcgccgcggtgtcgcgggtggccagggtccactacgccgagatcgtcgcctcgatcgcc
agccggtcggccggccccggcacccgcgccaacatcgacgagttcaccgaaaccacctcg
aaggccatcgaggcgatcggcggggcgcgcaagggcaaggcgatcatcgtcctcaacccg
gccgagccgccgctgatcatgcgcgacaccgtctacgtgctctccgcgccggccgaccgg
gcgcgggtcgaggcctccctcgcggaaatggcccaggcggtacagggctacgtgccgggc
tatcgcctcaagcagcgggtgcagttcgacgagatccccgacgccgcgccgctgaacatc
cccggcctcggccgcctgtccggcctgaagacctcggtgttcctcgaggtcgagggcgcc
gcccattacctgccggcctacgccggcaacctggacatcatgacctccgccgcgctggcc
accgccgagcgcatggcgcaatccatgctgaacgcctga

DBGET integrated database retrieval system