KEGG   Azotobacter vinelandii CA6: AvCA6_46670Help
Entry
AvCA6_46670       CDS       T02634                                 

Gene name
gabT
Definition
4-aminobutyrate transaminase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
avd  Azotobacter vinelandii CA6
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AvCA6_46670 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AvCA6_46670 (gabT)
   00310 Lysine degradation
    AvCA6_46670 (gabT)
Enzymes [BR:avd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AvCA6_46670 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     AvCA6_46670 (gabT)
Amino acid related enzymes [BR:avd01007]
 Aminotransferase (transaminase)
  Class III
   AvCA6_46670 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4736234..4737514)
Genome map
AA seq 426 aa AA seqDB search
MSRTNESLMQRRIAAVPRGVGQIHPIFAEHARNCSVVDVEGREYIDFAGGIAVLNTGHLH
PKVVEAVQRQLHKLSHTCFQVLAYEPYVELCEKLNARVPGDFAKKTLLVSTGSEAVENAV
KIARAATGRTGVIAFTSAYHGRTLMTLALTGKKVPYAAGMGLLPGGVFRARYPSALHGID
VAEALASVERVFKNDAEPRDIAAILVEPVQGEGGFNVAPPEFMRGLRAICDRHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTAFAKSIAGGFPLAGVCGRAEPMDAIAPGGLGGTYA
GSPLACAAALAVLEVFEEERLLERARDIGARLSEGLRAIQGRHPSIVEVRGLGAMVAMEL
CEGGDPHKPATALTGQLVVRARDKGLILLSCGAYGNVLRFLMPLTVPDELLERGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaccaacgaatccctgatgcaacgccggatcgccgcggtgccgcgcggcgtc
gggcagatccacccgatcttcgccgagcatgcgcgcaactgcagcgtggtcgacgtggag
gggcgcgagtacatcgacttcgccggcggcatcgccgtgctcaacaccggccacctgcac
ccgaaggtcgtcgaggcggtgcagcggcaattgcacaagctgtcgcacacctgcttccag
gtgctggcctacgagccctacgtcgagctctgcgaaaagctcaacgcgcgcgtgccgggc
gacttcgccaagaagaccctgctggtcagcaccggctcggaggcggtggagaacgccgtg
aaaatcgcccgcgccgccaccgggcggaccggggtgatcgccttcaccagcgcctatcac
gggcgcaccctgatgaccctggcgctgaccggcaagaaggtgccctacgccgccggcatg
ggccttctgcccggcggcgtgttccgcgcccgctaccccagcgcattgcacggcatcgac
gtggccgaggcgctggccagcgtcgagcgggtgttcaagaacgacgccgagccgcgcgat
atcgccgcgatcctggtcgagccggtgcagggtgagggtggcttcaatgtcgccccgccg
gagttcatgcgcggcctgcgggcgatctgcgaccgccacggcatcctcctgatcgccgac
gaggtacagaccggcgccggacgcaccggcaccttcttcgccatggagcagatgggcgtg
gccgccgacctcaccgccttcgccaagtccatcgccggcggttttccgctggccggcgtg
tgcggccgggccgagcccatggacgccatcgctcccggcgggctcggcggcacctatgcc
ggcagcccgctggcctgtgccgcggccctggcggtgctggaggtgttcgaggaagagcgc
ctgctggagcgcgcccgggacatcggcgcgcggctgagcgaagggctgcgggcgatccag
gggcgtcatccgtcgatcgtcgaggtacgcggtctcggcgccatggtcgccatggagctg
tgcgagggcggcgatccgcacaagccggccaccgcgctgaccggacaactcgtcgtccgg
gcgcgggacaaggggctgatcctgctgtcctgcggcgcctacggcaacgtgctgcgtttc
ctgatgcccctgaccgtcccggacgaactgctcgaacgcggcctggcgattctcgccgag
tgcttcgacgaactggcctga

DBGET integrated database retrieval system