KEGG   Archaeoglobus veneficus: Arcve_0051Help
Entry
Arcve_0051        CDS       T01451                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ave  Archaeoglobus veneficus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcve_0051
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arcve_0051
Enzymes [BR:ave01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Arcve_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48919..50652
Genome map
AA seq 577 aa AA seqDB search
MLTRVLTIDLSSYTYSIDDRRDLFEEWLGGVGVAVQLLKENMDVNADPLSEENVIVFAVG
PLTSAYPLASKTVALFKSPLTGNLGESHAGGRTATSMANAGYGAIVIKGRSKKPVYVVID
NGKVHFRDARVIWGIEDSLIVGRIIAEKEPGRGTRTVMRIGGGGEKLVRYACVTTETYRH
FGRLGLGAVFGSKNLKAIVINGRGSRKVVNRRAYREIYDEIFRLAIESNAMKKYHLIGTA
VNVNPLNEIGGLPTKNLKQTRFENAEEISGESLAERIGRRVACSHCPVACVHIAVLRLPY
ENEPYFYKTIMISYDYELIYSLGSMLGIGSKEGLLRLIHRVETYTLDAMSTGVCLAWATE
ALERGIISKEDTIVDLKFGDCDAYIKAIDYIVRQPNDFYKNLAYGVEHAAKVYGGKEFAL
TFGKNEMPGYHTGYAAHIGYLIGLRHSHLDNAGYSLDQKLKEYPEPEELVGKLIKEEQWR
QVLSSLVVCFFARGVYTADIVCKAFKPLGIEIGEDELNRIGEKIYFEKLRLKKQMGFDVS
KLRIPKRIFEVETPHGKLSEDYIRRALDYYAKIVSEV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgctgactagggtgctaacaatagacctctccagctatacatacagcattgacgacaga
agagacctctttgaggaatggttgggcggcgtgggtgttgcagttcagcttttaaaggag
aacatggatgttaacgccgatccgttaagcgaggagaacgtcatagttttcgctgtaggg
ccattaacgtcagcctatcctcttgcatcaaaaaccgttgctctattcaagagtccgcta
acgggaaaccttggtgaaagccatgcaggtgggagaactgcgacaagcatggcaaacgcc
ggatacggagctatagtgataaagggaagaagcaagaagcccgtttacgttgtaatagat
aacggcaaggtgcacttcagggacgccagagttatctggggaattgaggattcactcata
gtcggaaggatcattgcagaaaaagagcccggaagaggtacgaggactgtaatgaggata
ggagggggcggagagaagcttgtaagatacgcgtgcgttacgacggagacctacagacat
ttcggtaggcttggactgggagccgtcttcggttccaagaatctcaaggccatcgtcatc
aacgggagaggtagcagaaaggtcgtgaatagaagggcgtacagagaaatttacgacgag
atattcaggctggcaattgaatccaacgccatgaagaaataccatttaatcggcaccgcc
gtcaacgtaaaccccctcaacgagattggaggtttgccaactaaaaacctgaaacagacg
aggtttgagaatgcagaggagataagtggtgagagtcttgcagaaaggataggcagaagg
gttgcgtgcagccattgcccggttgcgtgcgttcacatagctgttttaaggctgccgtac
gagaacgagccgtatttctacaagaccatcatgatctcctacgactacgaactgatatac
tccctcggctcaatgcttggaatcggttcgaaggagggactgctcaggctaatccacaga
gttgaaacgtacacacttgatgccatgagtacgggagtgtgccttgcttgggcaacggag
gcgcttgaaagaggaattataagcaaagaagataccatcgtcgatttgaagtttggagac
tgtgatgcctacatcaaggcgatagactacatagtcagacaaccaaacgacttctacaag
aatttggcgtacggtgttgagcacgcagcgaaggtttacggtggaaaagagttcgcccta
actttcggtaaaaacgaaatgcccggataccatacgggatatgcagcacacataggctac
ctcattggactgagacatagccatctcgataatgcgggctactcgctggatcagaagctc
aaggagtatcccgagccagaagagctcgtcggaaagctcatcaaagaggagcagtggaga
caggtgctttcgagtctcgtggtgtgcttctttgcaagaggtgtttatacggcagatatt
gtatgcaaagccttcaagcctctcggaattgaaataggtgaggacgaactgaacaggata
ggggaaaaaatctacttcgaaaagctgagactgaagaagcagatgggctttgacgtgagc
aaactcaggataccgaagaggatattcgaagttgaaacaccccatggaaagctgagcgaa
gactacatcagaagagcactcgactactacgcaaagatcgtcagcgaagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system