KEGG   Archaeoglobus veneficus: Arcve_0083Help
Entry
Arcve_0083        CDS       T01451                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcve_0083
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcve_0083
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arcve_0083
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arcve_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
77975..79162
Genome map
AA seq 395 aa AA seqDB search
MEYYLRCIDCGKKYEREDIYTCECGGLLEVAIDFDSVEIDFKFDGNELRVWKYRCLLPVK
REPVSLKEGGTPLYHATKLAEELGCKVYVKHEGANPSGSFKDRGMTVGVTKAIELGRNAV
ACASTGNTSASMAMYAAKAGLKAYVLLPAGKVALGKVAQALMHGAKVIGIRGNFDEALAL
VRKISEEEGFYLLNSVNPFRLEGQKTIAYEIVDEIGTPDRVVLPVGNAGNISAIYKGFKE
LKELGLIDSIPKMSGVQAEGANPIYKAVMECREDIDPVLKPETVATAIRIGQPVNAKKAL
RAIYESNGTAVQVSDEEIIRAQKDLAAKEGIGVEPASAASVAGLRKLVAEGVVERDETVV
CITTGHLLKDPEAVIRACGQPIEVDASLEAIRAVL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaatactaccttcggtgcatcgactgcggtaaaaaatacgagagagaagacatatac
acgtgtgagtgtggcggattgcttgaggttgccatagactttgattccgttgaaatcgac
ttcaaatttgatggcaacgagttgagagtctggaagtatcgctgcttgcttccagttaaa
agagaaccggtatcgcttaaagagggtggaacaccgctgtatcacgctacaaagcttgca
gaagagcttgggtgtaaagtttacgtcaagcatgaaggagcaaatccatccggatctttc
aaagatagaggtatgactgtaggagttacaaaggcaatagagctcggtagaaacgccgtt
gcctgcgcatcgacaggcaatacctcagcatccatggcaatgtatgctgcgaaggctggc
ttaaaggcctacgttttgcttccagcaggtaaggtggcgctgggcaaggttgctcaggct
ttgatgcacggtgcgaaggttatagggatcaggggaaacttcgatgaagctcttgctctt
gtgagaaagataagcgaagaggaaggattctatttgctcaactctgttaaccccttcagg
ctcgaggggcagaagacgatagcctacgagatcgtggatgaaataggaacgccggacaga
gttgtactgcccgtaggaaatgcaggcaacatctcggcgatatacaaggggtttaaagag
ctcaaagaacttggcctgatcgactcaattccgaaaatgtcgggtgtgcaggccgaaggg
gcgaaccccatctacaaggccgttatggagtgtagggaggacatagatccagttttaaag
cctgagaccgttgctactgcaataaggattggtcagcccgtaaatgcgaagaaggcttta
agggcgatatacgagtcgaatgggacagcagttcaggttagtgacgaagagatcatccgt
gctcagaaagatttggcggcaaaggagggaattggcgttgagcctgcgagtgctgcaagt
gttgctggtctgagaaagctcgtggccgagggagtagttgagagagatgagactgttgtc
tgcataacaactggccacctgctcaaggatcctgaagcagtcataagggcttgcggtcag
cccattgaggttgatgcaagtctggaggcaattagggctgttctttaa

DBGET integrated database retrieval system