KEGG   Archaeoglobus veneficus: Arcve_0083Help
Entry
Arcve_0083        CDS       T01451                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcve_0083
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcve_0083
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arcve_0083
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arcve_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
77975..79162
Genome map
AA seq 395 aa AA seqDB search
MEYYLRCIDCGKKYEREDIYTCECGGLLEVAIDFDSVEIDFKFDGNELRVWKYRCLLPVK
REPVSLKEGGTPLYHATKLAEELGCKVYVKHEGANPSGSFKDRGMTVGVTKAIELGRNAV
ACASTGNTSASMAMYAAKAGLKAYVLLPAGKVALGKVAQALMHGAKVIGIRGNFDEALAL
VRKISEEEGFYLLNSVNPFRLEGQKTIAYEIVDEIGTPDRVVLPVGNAGNISAIYKGFKE
LKELGLIDSIPKMSGVQAEGANPIYKAVMECREDIDPVLKPETVATAIRIGQPVNAKKAL
RAIYESNGTAVQVSDEEIIRAQKDLAAKEGIGVEPASAASVAGLRKLVAEGVVERDETVV
CITTGHLLKDPEAVIRACGQPIEVDASLEAIRAVL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaatactaccttcggtgcatcgactgcggtaaaaaatacgagagagaagacatatac
acgtgtgagtgtggcggattgcttgaggttgccatagactttgattccgttgaaatcgac
ttcaaatttgatggcaacgagttgagagtctggaagtatcgctgcttgcttccagttaaa
agagaaccggtatcgcttaaagagggtggaacaccgctgtatcacgctacaaagcttgca
gaagagcttgggtgtaaagtttacgtcaagcatgaaggagcaaatccatccggatctttc
aaagatagaggtatgactgtaggagttacaaaggcaatagagctcggtagaaacgccgtt
gcctgcgcatcgacaggcaatacctcagcatccatggcaatgtatgctgcgaaggctggc
ttaaaggcctacgttttgcttccagcaggtaaggtggcgctgggcaaggttgctcaggct
ttgatgcacggtgcgaaggttatagggatcaggggaaacttcgatgaagctcttgctctt
gtgagaaagataagcgaagaggaaggattctatttgctcaactctgttaaccccttcagg
ctcgaggggcagaagacgatagcctacgagatcgtggatgaaataggaacgccggacaga
gttgtactgcccgtaggaaatgcaggcaacatctcggcgatatacaaggggtttaaagag
ctcaaagaacttggcctgatcgactcaattccgaaaatgtcgggtgtgcaggccgaaggg
gcgaaccccatctacaaggccgttatggagtgtagggaggacatagatccagttttaaag
cctgagaccgttgctactgcaataaggattggtcagcccgtaaatgcgaagaaggcttta
agggcgatatacgagtcgaatgggacagcagttcaggttagtgacgaagagatcatccgt
gctcagaaagatttggcggcaaaggagggaattggcgttgagcctgcgagtgctgcaagt
gttgctggtctgagaaagctcgtggccgagggagtagttgagagagatgagactgttgtc
tgcataacaactggccacctgctcaaggatcctgaagcagtcataagggcttgcggtcag
cccattgaggttgatgcaagtctggaggcaattagggctgttctttaa

DBGET integrated database retrieval system