KEGG   Archaeoglobus veneficus: Arcve_0203Help
Entry
Arcve_0203        CDS       T01451                                 

Definition
(GenBank) PfkB domain protein
Organism
ave  Archaeoglobus veneficus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(181097..181975)
Genome map
AA seq 292 aa AA seqDB search
MIAGVGPALVDHIYSIDSYPQRGGQAIVRNSVKEAGGAAANVIYGLASFGLPCRFYSTIG
TDSDADFFISSLKKVGVDVRAAVTHPETGRVDIYVDSEGERTFFVHPNAAGSAAVSIPNG
DYDEVEYFYLDPFPAANSFEIHLEIARKATERGKTVILNPGHPYSAMGFERLSELLQYTD
IVILSLPEFEMLGGNAEKFLEFVDVLVVTMSEKGCKAYSDEKSVHCPAFRVKVVDTTGAG
DAFSAGFLYGYVKGYSLEKCLKAGNFVAAYSIQHYGARTFPPVRDVDRVLSE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgattgctggtgtagggcctgcgctcgttgaccacatctactcaatagactcctacccg
cagaggggagggcaggctattgtaaggaattcggttaaagaggcaggaggcgctgcagca
aacgttatatatgggctcgcttcctttggtttgccgtgcagattctactccacaattgga
acagacagcgatgcggacttttttatctcaagtttgaaaaaagtcggagttgatgtaaga
gctgctgttacccatcctgaaactggcagggtggacatctacgtggacagcgagggtgaa
agaaccttcttcgtccatccaaacgccgcgggttctgctgctgtttcaatccccaacggg
gattacgatgaggttgaatacttttatcttgacccatttcccgctgcgaacagctttgaa
atccatctcgagatagcaaggaaggcaacggagagaggaaagaccgttatcctgaatccc
ggccacccctactcggccatgggattcgaaagactttcagagctgttgcagtacacagac
attgtaattctctcgcttccggaattcgagatgctgggagggaacgcagagaagtttctt
gagtttgttgacgtactcgtcgttaccatgagcgaaaaaggatgtaaagcttacagcgat
gaaaagagtgtgcactgcccggcgttcagagttaaggttgttgacacaaccggggcggga
gacgctttttctgctggcttcctctacggttacgtgaaaggctactcgctggagaagtgt
ctgaaagccggaaatttcgttgctgcgtacagcatccagcattatggggcgaggactttt
ccgcccgttagagatgttgacagggttctttcggaataa

DBGET integrated database retrieval system