KEGG   Archaeoglobus veneficus: Arcve_0313Help
Entry
Arcve_0313        CDS       T01451                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ave  Archaeoglobus veneficus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ave00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
270258..271403
Genome map
AA seq 381 aa AA seqDB search
MSIYAFAEIEEGKVKRINASARYPSKQSGNVFYDADEVICSDDAPLRIKGFHAIVAFKAR
HVFISRDVVGGKPLYYNPEEFAFSSFKSYFDTEAIELMPGEVLKLNYDGSIEERHYYSFH
DVFRKEEASVDELVERIEKSLENFKPGNSCIAFSGGVDSSLLAALYDVQLINVTASREEE
EHVRYAAKLLGREIEVYRFGEQEVKEVLPEVVKAIETTNPLQVSIGIPVYLAMKFAKSLG
YNQVIFGQGADELFGGYKRYESLNYEELEDALLSDVKNLGKNNLVRDVKLSYRAEVKLLT
PYLQWDIISAAMNIPVDLKVRREDGRVIRKYVLRKIAEKYVPKELAYRDKKAVQYSTKTS
TILEKIAKKAGMNLAEYLEGL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtccatatacgcctttgcagaaattgaagaaggaaaggtaaagcgcatcaacgcttca
gcccgctatccttcgaagcagagtggtaacgttttttacgatgcggatgaggttatctgt
tcagacgacgcgcccctgagaataaagggctttcacgccatagttgcgttcaaggcaagg
cacgtctttatttcgagggacgtggttgggggcaaacccctttactacaaccctgaggag
ttcgccttttcatccttcaagagctacttcgacactgaggcaatagaactcatgcctggc
gaggttttaaagctgaattacgatggcagcatagaggagcgacattactacagcttccac
gatgtcttcagaaaagaggaggcgagtgttgacgaacttgttgagagaattgaaaagtcg
ttggaaaactttaaacccggtaattcgtgcattgccttctcaggtggtgttgattcttcg
ctgctcgcagctctctacgacgtccagctcatcaacgttacggccagcagagaagaggag
gagcacgtaagatatgcagcaaagcttcttggcagagagattgaggtctacaggtttggc
gaacaagaagtaaaagaagtgctgcctgaagtcgttaaagcaattgaaacgacgaaccca
ctgcaggtttctataggaatcccggtctatctcgccatgaagtttgcgaaatcccttggc
tacaaccaggtaatctttggtcagggagctgacgagctctttggtggatacaagcgctac
gagtctttaaactatgaagaacttgaggatgcattgctcagtgatgtaaagaacctcggt
aagaacaacctcgtgagggatgtgaagttgtcttacagagctgaagtaaagctgcttaca
ccctatctccagtgggatattatatcggctgcaatgaacattcccgttgacctgaaggtc
aggagagaagatggcagggttatcaggaagtacgtcctgaggaaaattgcggaaaaatat
gttccgaaagagcttgcgtacagggataagaaagcggtgcagtactctacgaaaacttct
acaattctggaaaagattgccaaaaaagctggtatgaaccttgctgagtatcttgagggg
ttatga

DBGET integrated database retrieval system