KEGG   Archaeoglobus veneficus: Arcve_0328Help
Entry
Arcve_0328        CDS       T01451                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcve_0328
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_0328
   00620 Pyruvate metabolism
    Arcve_0328
   00640 Propanoate metabolism
    Arcve_0328
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcve_0328
   00680 Methane metabolism
    Arcve_0328
Enzymes [BR:ave01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Arcve_0328
Lipid biosynthesis proteins [BR:ave01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Arcve_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
284868..286841
Genome map
AA seq 657 aa AA seqDB search
MSEEPKVIESLLKVEETYEPPADFREKAWVKDDSVYKKAEEDFISFWDEIAKTEIEWFEP
YEKVLDDSNAPFYKWFIGGKINITYNCLDRHVKSWRKNKAAIIWQGEPEEDKRVITYYEL
YRRVCRFANALKKLGVKKGDRVTIYMGMVPELPVAMLACARIGAIHSVVFGGFSASALRD
RINDAQAKVVITMDGFYRRGKVVETKRIVDEALEDAPSVQNVVVLKRIGNEINMEEDRDI
WWHDLQYGVTPECEPEVVDSEHPLFILYTSGTTGKPKGVLHVHGGYNVGTHITTKWIFDL
KDDDIYWCTADIGWITGHSYIVYGPLSNGATVLMYEGAPDYPQPDRWWSIIERYGVTVFY
TAPTAIRFFMRLGEEWPKKHDLSSLRLLGTVGEPINPEAWKWYYKYIGNEKCPIVDTWWQ
TETGMILISPLPGVTKLKPGSATLPFPGVVADIYDEDGNPVPPNTGGKLVITRPWPSMLR
TLWGDPDRYVRQYWSAYKDKLVYFTGDGARRDEDGYFWIIGRIDDVLNVSGHRIGTAELE
SALVAHKAVSEAAVIGKPHEVKGEVPVAFVVLKAGYEPTPELKKELKNWVRKEIGPIAVP
EEIHFLEKLPKTRSGKIMRRILRAIEKGEAIGDVTTLEDETAVEEAKKKVVEEEQKG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaaccaaaggtaatcgaaagcctccttaaagtagaagagacttacgagcct
cctgcagacttcagagaaaaagcgtgggtgaaagacgacagcgtatacaagaaggcagaa
gaggacttcatttccttctgggatgaaatagcaaaaacggaaattgaatggttcgaaccc
tatgagaaggttcttgatgacagcaacgcacccttttacaagtggtttattggtggaaag
atcaatataacctataactgtctcgacaggcatgtcaagagctggagaaagaacaaggca
gcgataatctggcagggtgaaccggaggaggacaagagagtcataacatactacgaactc
tacagaagggtatgcaggtttgcaaacgctttgaagaagcttggagtgaagaagggcgat
agagtaaccatttacatgggaatggttcccgagttgccagttgctatgctcgcatgtgcc
cgtattggcgcaattcacagcgtcgtttttggtggtttctctgcttcggctctaagagac
aggataaacgatgctcaggcaaaggtagtaattacaatggacgggttctacaggagaggc
aaggtcgtggaaacgaagcgcatcgttgacgaggcgctggaggatgcgccaagtgttcag
aatgttgttgtcctcaagagaattggcaacgagataaacatggaggaggacagggatatc
tggtggcatgacttgcagtatggcgtgactccggagtgtgagccagaagttgttgacagc
gagcacccgttattcatcctgtacacatccggaactaccggcaagccgaagggcgttctt
catgtgcatggtggatacaacgttggcacgcacatcacgacgaagtggatcttcgatttg
aaggatgatgacatctactggtgtactgctgacataggctggattacgggccacagctac
atcgtttatggcccactttccaacggtgcaaccgttctcatgtatgaaggtgctcccgat
tacccgcagcccgacaggtggtggagcataatcgagcgctatggcgtgacggtgttctac
accgctccgactgcaatcaggttcttcatgagactcggtgaggagtggcccaagaaacac
gatttgagtagtctaaggttgcttggtactgtcggagagccgataaatcccgaggcgtgg
aagtggtactacaagtacataggcaacgagaaatgcccgatcgttgacacctggtggcag
acggaaacgggtatgattctgatttcacctctacccggagtcacgaagctcaagccaggt
tcagcaactctgcccttcccgggtgtcgttgcagacatatacgatgaagatggaaatccc
gtcccaccgaacactggaggaaagctcgttatcacgaggccgtggccatctatgctgcga
acgctgtggggcgacccagaccgctatgtgaggcagtactggagcgcatacaaggacaag
ctcgtttactttactggcgacggagcaagaagggacgaggacgggtacttctggataata
ggcagaattgacgatgtcctcaatgtgagcggccacaggattggaacggccgaacttgag
agtgcactcgttgcccacaaggctgtgagcgaggctgcagtcataggcaagccccacgag
gtcaagggtgaagtgccagttgccttcgtagtccttaaggctggttatgaaccaactccg
gagcttaagaaggagctcaagaactgggtgagaaaggagatcggcccgattgctgtaccg
gaggagatacacttcctggagaaactgccgaagacgaggagcggtaagataatgcgcagg
attctgagggcaatagagaagggtgaggccataggagacgtcacgactctcgaggacgag
acggctgttgaggaggcgaagaagaaggtagttgaggaagagcagaagggttga

DBGET integrated database retrieval system