KEGG   Archaeoglobus veneficus: Arcve_0503Help
Entry
Arcve_0503        CDS       T01451                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ave  Archaeoglobus veneficus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcve_0503
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Arcve_0503
Exosome [BR:ave04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arcve_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
429764..430711
Genome map
AA seq 315 aa AA seqDB search
MRRLRKDSLRPLVRESRLSVEDLIMPVFVDENISAKKEIPSMPGYYRIPLGGVAEEVGRA
MEKGIKAFILFGIPSYKDEVGSSAFDKNGVVQKAVREIKAEHSDAVVVTDVCLCEYTTHG
HCGVVRDGIILNDETLPILGKTAVSHAEAGADIVAPSGMMDGMVKAIRNALDAEGFQDVA
IMSYSAKYASSFYGPFREAAESGYAFGDRRSYQMDFHNSSEALREVELDIREGADIVMVK
PALSYLDVIRKVKDKFGYPTAAYNVSGEYSMVKAAGKMGWLDEKQIAYEILVSIKRAGAD
LIITYHAMEIADFLG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagaagactgaggaaagactcgctaagaccgcttgtccgagaaagtaggctcagcgtt
gaagacctgataatgcctgttttcgttgacgagaacatctccgcgaagaaagaaattcca
tcgatgcccggttattatcgtatccccctcggtggagttgccgaagaggttggcagggcc
atggagaagggtataaaggcgttcatactttttggcattccctcttacaaggatgaggtc
ggctcatctgcttttgataaaaatggagttgttcagaaggctgtgagagaaattaaagcc
gaacacagcgatgcagtcgtcgttacggacgtctgcctgtgcgagtacaccacgcacggt
cactgcggtgttgtgagagacggaatcatcctgaacgacgaaaccctgccaattctcgga
aagacggccgtaagccacgcagaagcaggggcagacatcgtggcaccttcaggcatgatg
gatggtatggttaaggccatcagaaatgcgcttgatgcggagggctttcaggatgttgcc
ataatgagctattctgcgaagtacgcatcgagcttctacggccccttccgcgaagcagcg
gaaagcggctacgctttcggcgatagaagaagctaccagatggactttcacaacagcagc
gaagcacttcgagaagttgaactggacataagggaaggggcagacatcgtaatggtcaag
ccagcactatcgtacctcgacgtgataaggaaggttaaggacaaattcggctatccaacc
gcagcttacaacgtgagtggcgaatactcaatggtcaaggctgctggaaaaatggggtgg
ctcgacgagaagcagattgcctacgagatcctcgtatcgataaagagagcaggagcagac
ctgattattacgtatcacgcaatggagatcgctgattttctcgggtag

DBGET integrated database retrieval system