KEGG   Archaeoglobus veneficus: Arcve_0551Help
Entry
Arcve_0551        CDS       T01451                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00521  Streptomycin biosynthesis
ave00523  Polyketide sugar unit biosynthesis
ave01130  Biosynthesis of antibiotics
Module
ave_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Arcve_0551
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arcve_0551
Enzymes [BR:ave01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Arcve_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2 FdtA
Motif
Other DBs
NCBI-ProteinID: AEA46575
JGI: Arcve_0551
UniProt: F2KQE2
Position
475353..475850
Genome map
AA seq 165 aa AA seqDB search
MLPGIVVKPLKRFADERGFFTEIMRKDWEIFEDEIVQANLSITYPGIVRAWHKHERGQVD
YFVCVKGAIKICAYDDETQELNEIVSTGENPQIVRVPGHYWHGFKAVGNEPAMLVYFVNK
LYDYENPDEVRRPWNDPTVVPKVINGREDDPRCGKPWDWFYPPHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccggaatcgttgtaaaacccttaaagaggttcgccgacgaaagaggtttcttc
accgagataatgcgtaaggactgggaaatatttgaggatgaaatagttcaggctaaccta
tccatcacataccccggaatcgttagagcgtggcacaaacacgaaagggggcaagttgac
tacttcgtctgcgtgaaaggggcaatcaagatatgtgcttacgatgacgaaactcaagag
ctgaacgaaatcgtttcgacaggcgagaatccccagattgttagagttcccggccactac
tggcacgggtttaaagctgttgggaacgaaccagcaatgctcgtttactttgttaacaaa
ctctacgactacgaaaatccagatgaagttagaagaccttggaacgaccccacggttgtg
cctaaagttataaatggcagagaagatgatccgaggtgtggcaagccgtgggactggttc
tacccaccgcataagtag

DBGET integrated database retrieval system