KEGG   Archaeoglobus veneficus: Arcve_0887Help
Entry
Arcve_0887        CDS       T01451                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00010  Glycolysis / Gluconeogenesis
ave00620  Pyruvate metabolism
ave00640  Propanoate metabolism
ave00680  Methane metabolism
ave00720  Carbon fixation pathways in prokaryotes
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01130  Biosynthesis of antibiotics
ave01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_0887
   00620 Pyruvate metabolism
    Arcve_0887
   00640 Propanoate metabolism
    Arcve_0887
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcve_0887
   00680 Methane metabolism
    Arcve_0887
Enzymes [BR:ave01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Arcve_0887
Lipid biosynthesis proteins [BR:ave01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Arcve_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEA46901
JGI: Arcve_0887
UniProt: F2KSD2
Position
756946..758889
Genome map
AA seq 647 aa AA seqDB search
MSNSKEFSPGEIYEPSEETRKYAWVNNERIYEMAQDYLTFWDEVAKNDVEWFEPYEDVLD
DSNAPFYRWFVGGKINITHNCLDRHIKLKGDKTAIIWQGEPENEKEKITYHELYQRVCRF
ANALRTLGVEEEEDVVTIYMGMVPELPIAMLACARIGAIHSVVFGGFSSKALRDRINDAE
SKVVVTMDGYYRRGKVVETKRIVDEALENAPSVESVVVLERTGNDVNMVEGRDVWWHELE
EGLPDKCECRPLDSEHTLFILYTSGTTGKPKGVLHVHGGYNVGTHITTKWVFDLKDRDIF
WCTADIGWITGHSYVVYGPLSVGATVLMYEGAPDHPQPDRWWSIIEQYGVTILYTAPTAI
RYFMKLGEEWPKKHDLSSLRLLGTVGETIDPKAWKWYYKHIGNERCPIVDTWWQTETGMI
MITPLPGITKLKPGSATLPFPGIEVDIRDEKGYSADSGELVITNPWPAMFRTLWGEPERF
AKQYWRSNGGLIYYTGDGARKDENGYYWIIGRIDEVLKVSGHRLGSAEIEGALISHEAVS
EAAVVGKPHEIKGETPVAFVVLKTGYEPSVELEEDLKKHVRNEIGAIAVPEGIYFVEQLP
KTRSGKIMRRILLAIEKGEEVGDITTLEDVTVVEKIKEVMMARKTEQ
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattcaaaagaattttccccaggcgagatatatgagccatcagaagaaaccaga
aagtatgcgtgggttaacaacgaaagaatctacgaaatggctcaagattatcttacattt
tgggatgaggttgcaaagaatgacgttgaatggtttgagccctatgaggacgtgctcgat
gacagcaacgctccgttttacagatggtttgttggtgggaagatcaacataacccacaac
tgcctggaccggcacatcaagttgaaaggagacaaaacagcaataatatggcagggagaa
cctgaaaacgagaaagagaagataacttaccacgagctctatcagagagtttgcagattc
gccaatgccctcagaacgcttggagttgaggaggaggaggacgttgttacgatctacatg
ggaatggttcccgagttgcccattgcgatgctcgcatgcgccagaattggcgccatccac
agcgtagtttttggtggattctcctcgaaggctctaagagacaggataaacgacgccgag
tctaaagtggtagttacgatggatggttactacagaaggggcaaggttgttgagaccaag
cgcatcgttgatgaggcgttggaaaatgcaccgagcgttgagagcgtcgtcgtattggag
agaaccggcaatgatgtgaatatggttgaaggcagggacgtctggtggcatgaactggaa
gaaggtcttcccgacaaatgtgagtgcagacctcttgacagcgaacatacgttgttcata
ctctacacatctggcacaacaggcaagccgaagggtgttcttcacgttcatggaggttac
aacgttggcacacacatcacgacgaagtgggttttcgatttgaaagacagggacatattc
tggtgtactgctgatataggctggattactggccacagctacgttgtctatggacctctt
tcagtcggcgcgaccgttttaatgtatgagggagccccagaccacccgcagccggacaga
tggtggagtataattgagcagtacggtgtaactattctctacaccgctcccactgcaata
cgctacttcatgaaacttggcgaggagtggccaaagaaacacgatctatcctcgttgcgt
ctgcttggaacagtcggagaaactatagaccccaaagcttggaagtggtactacaagcac
ataggaaacgagcgctgcccaatcgtcgacacatggtggcagacagaaacgggcatgatt
atgataactcccctaccaggaattacgaagctcaagcccggttctgcaacgctgcccttc
cctggcattgaagtagacatacgcgatgagaaagggtattcagcagacagtggagaactc
gtgataacgaatccgtggccagcaatgttcagaaccctatggggtgagccagaaagattt
gccaaacaatactggcggtcaaatggtggactcatctactatacaggggatggagcaagg
aaggatgaaaacggatactactggataattgggaggattgatgaggttttgaaggtcagc
ggtcacagacttggaagtgctgaaatcgaaggcgcactcatatctcacgaggctgtaagt
gaggcggccgtcgttggtaagccccacgaaatcaagggggagacgccagtcgcatttgtt
gtccttaagacgggctacgagccaagcgtcgaacttgaagaagatctcaagaagcatgtt
agaaacgaaataggtgcaatagctgtaccagaggggatatactttgttgaacagcttcca
aaaacgagaagcggaaagataatgcgcaggattctacttgccatcgagaagggcgaggag
gtaggcgacatcacaacccttgaagacgttacggttgttgagaagattaaggaggttatg
atggcgagaaaaactgaacaatga

DBGET integrated database retrieval system