KEGG   Archaeoglobus veneficus: Arcve_0905Help
Entry
Arcve_0905        CDS       T01451                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00010  Glycolysis / Gluconeogenesis
ave00030  Pentose phosphate pathway
ave00051  Fructose and mannose metabolism
ave00680  Methane metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01130  Biosynthesis of antibiotics
ave01200  Carbon metabolism
ave01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_0905
   00030 Pentose phosphate pathway
    Arcve_0905
   00051 Fructose and mannose metabolism
    Arcve_0905
  Energy metabolism
   00680 Methane metabolism
    Arcve_0905
Enzymes [BR:ave01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Arcve_0905
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Arcve_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEA46916
JGI: Arcve_0905
UniProt: F2KSE7
Position
complement(773732..774847)
Genome map
AA seq 371 aa AA seqDB search
MGEKITVSLIKADVGSVPGHVVVPDEIKKVAEAFLEEKKQNGDIIDYRVLNVGDDLELIM
THREGVDSEKIHGIAWETFELATKRAKELKLYGAGQDLLKEAFSGNIRGLGPGVAEMEFT
ERGAEPLLAFMMDKTEPGAFNLPIFRIFADPFNTAGLVIDPSLHNGFVFEIWDIVEHKRV
FMNSPEEMYDILALIGGKSRFVIKRIFPKEGSKLPADEPVATVSTEKLFQIAGEYVGKDD
PVALVRAQSGLPAVGEVLEPFAFPHLVSGWMRGSHNGPIMPVPFHYAKCTRFDGPPRVIG
AGFQICNGKLVGPVDLFDDPAFDYTRQKAAEIAEYMRRHGPFEPHRLPHEDMEYTTLPKV
LDKLKDRFEDV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaaaataaccgttagcctgatcaaggcagacgtcggtagtgtgcccggccac
gtggttgtgcctgacgagataaagaaggtggcagaagcgtttctcgaggagaaaaagcag
aatggagatatcatagactacagggttctgaacgtaggtgacgacctcgagctgattatg
acccaccgcgagggtgtggacagcgagaaaatccacggcatcgcttgggagacgttcgaa
cttgctaccaaaagggcgaaggagctgaaactctacggagctgggcaggatttgctcaaa
gaagcattttcaggaaatatccgcggcttaggcccaggtgttgccgaaatggagttcaca
gagagaggagcagagccgctcctggcgttcatgatggacaagacagagccaggggcgttt
aacctgcccatattcaggatatttgctgatccgttcaacaccgctggcctcgtaatcgac
ccatctctgcacaacggattcgttttcgaaatctgggacatcgtcgagcacaaacgtgtg
ttcatgaactctccagaggagatgtacgacatcctcgcactgataggtggcaagtcgagg
ttcgtcataaagaggattttccccaaggagggtagtaaactgccagctgatgagccagta
gctacggttagcacagaaaagctcttccagattgccggagagtacgttggcaaggatgac
ccggtagcccttgtgagagcccagtcgggtctgccggcagttggagaagtcctcgagcca
tttgcgttcccgcacctcgtcagcgggtggatgcgaggaagccacaacggtccgattatg
ccggtaccgtttcactacgcaaagtgcacacgcttcgatggcccaccgagagtaattgga
gctggtttccagatctgcaacggtaagctcgtagggcccgttgacctcttcgacgacccg
gccttcgactacacaaggcagaaggcagcggagatagcagagtacatgcgccgccacggc
ccgttcgagccccacaggctgccgcacgaggacatggaatacaccacgctgccgaaggtt
cttgacaagctcaaggacagatttgaggatgtttag

DBGET integrated database retrieval system