KEGG   Archaeoglobus veneficus: Arcve_0905Help
Entry
Arcve_0905        CDS       T01451                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcve_0905
   01230 Biosynthesis of amino acids
    Arcve_0905
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_0905
   00030 Pentose phosphate pathway
    Arcve_0905
   00051 Fructose and mannose metabolism
    Arcve_0905
  Energy metabolism
   00680 Methane metabolism
    Arcve_0905
Enzymes [BR:ave01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Arcve_0905
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Arcve_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(773732..774847)
Genome map
AA seq 371 aa AA seqDB search
MGEKITVSLIKADVGSVPGHVVVPDEIKKVAEAFLEEKKQNGDIIDYRVLNVGDDLELIM
THREGVDSEKIHGIAWETFELATKRAKELKLYGAGQDLLKEAFSGNIRGLGPGVAEMEFT
ERGAEPLLAFMMDKTEPGAFNLPIFRIFADPFNTAGLVIDPSLHNGFVFEIWDIVEHKRV
FMNSPEEMYDILALIGGKSRFVIKRIFPKEGSKLPADEPVATVSTEKLFQIAGEYVGKDD
PVALVRAQSGLPAVGEVLEPFAFPHLVSGWMRGSHNGPIMPVPFHYAKCTRFDGPPRVIG
AGFQICNGKLVGPVDLFDDPAFDYTRQKAAEIAEYMRRHGPFEPHRLPHEDMEYTTLPKV
LDKLKDRFEDV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaaaataaccgttagcctgatcaaggcagacgtcggtagtgtgcccggccac
gtggttgtgcctgacgagataaagaaggtggcagaagcgtttctcgaggagaaaaagcag
aatggagatatcatagactacagggttctgaacgtaggtgacgacctcgagctgattatg
acccaccgcgagggtgtggacagcgagaaaatccacggcatcgcttgggagacgttcgaa
cttgctaccaaaagggcgaaggagctgaaactctacggagctgggcaggatttgctcaaa
gaagcattttcaggaaatatccgcggcttaggcccaggtgttgccgaaatggagttcaca
gagagaggagcagagccgctcctggcgttcatgatggacaagacagagccaggggcgttt
aacctgcccatattcaggatatttgctgatccgttcaacaccgctggcctcgtaatcgac
ccatctctgcacaacggattcgttttcgaaatctgggacatcgtcgagcacaaacgtgtg
ttcatgaactctccagaggagatgtacgacatcctcgcactgataggtggcaagtcgagg
ttcgtcataaagaggattttccccaaggagggtagtaaactgccagctgatgagccagta
gctacggttagcacagaaaagctcttccagattgccggagagtacgttggcaaggatgac
ccggtagcccttgtgagagcccagtcgggtctgccggcagttggagaagtcctcgagcca
tttgcgttcccgcacctcgtcagcgggtggatgcgaggaagccacaacggtccgattatg
ccggtaccgtttcactacgcaaagtgcacacgcttcgatggcccaccgagagtaattgga
gctggtttccagatctgcaacggtaagctcgtagggcccgttgacctcttcgacgacccg
gccttcgactacacaaggcagaaggcagcggagatagcagagtacatgcgccgccacggc
ccgttcgagccccacaggctgccgcacgaggacatggaatacaccacgctgccgaaggtt
cttgacaagctcaaggacagatttgaggatgtttag

DBGET integrated database retrieval system