KEGG   Archaeoglobus veneficus: Arcve_0922Help
Entry
Arcve_0922        CDS       T01451                                 

Definition
(GenBank) Cellulase
Organism
ave  Archaeoglobus veneficus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 FeoA
Motif
Other DBs
NCBI-ProteinID: AEA46933
JGI: Arcve_0922
UniProt: F2KSG4
Position
790137..791186
Genome map
AA seq 349 aa AA seqDB search
MEDELFGLLEKLSNAHGISGYEDEIREVIKAELEDFVDEIKIDNLGNLIAIKNGSEQKLM
LAAHMDEIGFMVKYIDDRGFIRVTPIGGWFAQTVLNQRVILHGSKGKVYGVFGCKPPHIM
QEDERKKVIKIKDMFVDVGASNKDEVLEMGINIGTPITVDRELVRLGQKVTGKAFDDRAG
IAAMIAALKETKSDATIYAVGTVQEEVGLKGARTSAFAIEPSAAIALDVCVATDFPGAES
AHMDIKLGKGPAITVADAAGRGLIASKKVLDWLTESAQKSEIPYQLEVAEGGTTDATAIH
LTKAGIPTGVVSIPARYIHTPVEVIDIRDLKNTALLVARALERADRYFK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgaactttttggactcctggagaagctgagcaatgctcatggcataagcggg
tacgaggacgagataagggaagtaataaaggctgaacttgaggattttgttgacgagata
aaaattgacaaccttggaaaccttattgcgataaagaacggaagtgagcaaaagctaatg
cttgcagcccacatggacgagataggttttatggtgaagtacatcgacgacagaggattc
attcgcgtaacgccaatcggtggttggttcgctcagacagttctcaaccagcgcgtgatt
ttgcatgggagcaaaggcaaggtttacggtgtttttggttgcaagcctccacacatcatg
caggaggatgagaggaagaaagtcatcaagattaaagacatgttcgttgatgtgggggcg
tcgaacaaagacgaagtcttggaaatgggaataaacattggcactccgataacagttgat
agggagctcgtaaggcttggtcagaaggtaacgggaaaggctttcgatgatagagcgggt
atagcggcgatgatagcagcccttaaggaaacgaagagcgacgctacgatttacgcagtt
ggaactgttcaggaagaggtgggactaaaaggtgcgagaacgtctgctttcgccatagag
ccgagtgctgcaatagccctcgacgtatgcgttgctacagactttcctggtgctgaatca
gcgcacatggacataaaacttggtaaggggccggcaataactgtggctgacgcggcagga
aggggtctcatagcatctaaaaaggtactcgactggctcacagaaagtgcacagaagagc
gaaatcccataccagctcgaggttgccgaaggaggcacgacagatgcaactgcgatacac
ctcaccaaggcgggcattcccacaggagttgtaagcattcccgcaagatacatccacaca
cccgtcgaagttatagacatccgggatctcaaaaacactgcactactcgttgcaagggct
cttgaaagagcagacaggtacttcaagtag

DBGET integrated database retrieval system