KEGG   Archaeoglobus veneficus: Arcve_1145Help
Entry
Arcve_1145        CDS       T01451                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ave  Archaeoglobus veneficus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcve_1145
  Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_1145
Enzymes [BR:ave01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Arcve_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
999278..1000516
Genome map
AA seq 412 aa AA seqDB search
MSENGIDEMRVSEILERVESYRDLMVKTLCDLIRIKAISPDSGGEGEFDKAEYLMNLLDC
FEVERFDAPDSRAKGGIRPNIVARLEGRRKRTIWIVTHIDVVPEGDVRLWHTPPFEPVVK
DGRIYGRGSEDNGQPLVSSLFAAKAIADSGIKPEYTLCLAFVSDEETGSRYGIQHLLEQD
LFGRNDMFVVPDAGSSDGSMIEIAEKSILWLKFVVHGRQAHASMPHIAVNASREAMRFII
DLDEELHRRFDGRNDLFQPPHSTFEPTKREANVDNVNTIPGLDVSYMDCRILPEYDINDV
LAVVEDVRRKHEERGNGKIEVEVVQKESSPPTPEDSEVVKLLSKAIELARGVKPAVFGIG
GNTCAAFFRKAGYPTAVWSTVDGVAHQPNEYAVIENMVADAKVFALMPFLKV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacggaattgatgaaatgcgcgtgtctgaaatactcgagagagttgaatcc
taccgggatttgatggtgaaaaccctttgcgacctcattagaattaaagccataagtccg
gacagcgggggggaaggagagttcgataaggcagagtacctgatgaatttgctcgactgc
tttgaggtggagaggtttgacgccccggacagcagggcgaagggtggcatcaggccaaac
atcgtcgcaaggctcgagggaaggagaaagaggacgatatggattgtcacacacattgac
gtcgtgccggaaggtgatgtaaggctgtggcacacaccccccttcgagcccgtagtgaag
gacggaaggatttacggcagggggagcgaggacaacggccagcctcttgtttcatcctta
tttgccgctaaggcaattgcagactctggaataaagccagaatacactctctgcctcgcc
ttcgtgagcgacgaagaaaccggtagcagatacggaatacagcatctcctcgaacaggac
ttatttggcaggaacgacatgtttgtcgtgccggacgcgggaagcagcgatggaagcatg
atagagattgcagagaagagtattctctggctgaagttcgtggttcacggcaggcaggca
cacgcgagcatgccccacatagctgttaatgcgtccagagaagccatgaggtttatcata
gaccttgatgaagagcttcacaggaggtttgatgggagaaacgacctgtttcagccccct
cattcgacctttgaaccaacgaagagggaggcgaacgttgacaacgtaaatacgattcct
ggcctcgatgtgagctacatggactgtcgaattcttccggagtacgatattaacgacgtt
cttgctgtcgttgaagatgtgaggaggaagcatgaagaacgcggaaacgggaagattgag
gtggaggtagtccagaaggagtcgtctccgccaacgccagaagacagcgaggttgtaaag
ttgctttcaaaggccattgagcttgcgagaggtgtgaagccggcggttttcggaatagga
ggtaacacctgtgcggccttttttagaaaggctggttatccaacagccgtgtggagcacc
gttgacggcgttgctcaccagcccaacgaatacgcggttatagaaaatatggttgccgac
gcgaaggtgtttgcattgatgccctttctgaaggtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system