KEGG   Archaeoglobus veneficus: Arcve_1214Help
Entry
Arcve_1214        CDS       T01451                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ave  Archaeoglobus veneficus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Arcve_1214
Enzymes [BR:ave01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Arcve_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1065027..1065869
Genome map
AA seq 280 aa AA seqDB search
MHIDSFFACSNSNIDEAEFVVFGIPYDATQSFKPGSRFAPNAIREASWNLEDFSLFSRFS
LYRAKICDAGNINVDGDFEAVASRVEEFMSGLSGIPIALGGEHTVSYACAKNFEEVCFVV
FDAHFDLRDKFDGNPFNHACTSRRVYELGHKLILIGVRSCTEEELQFAEEGGIKFYTSFD
VIKKGMAAILKEIEGEISDRVYLSVDVDAFDPAYAPGVSTPEPFGITPFDYLAFLEKFAD
RIVGMDVVEVVPDSEKVTQILAAKLVVEFIARKHTSSFFR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcacatagattctttttttgcgtgctccaattcaaatattgacgaagcggaattcgta
gtatttggaattccatacgacgctacgcaatcatttaagcccggttcccgctttgccccc
aacgccataagggaggcaagctggaacctcgaagatttttccctcttttcccgcttttca
ctttacagagcaaagatatgcgatgcgggcaacatcaatgtcgatggggactttgaagct
gtagcctcgagggtagaggagttcatgagcggtctgtcgggcattcccatcgcccttggt
ggggagcacaccgtaagctacgcatgcgctaagaacttcgaagaagtttgcttcgttgtt
ttcgatgcgcacttcgatttaagagataaattcgacggtaatccctttaaccacgcttgt
acgtcgaggagagtatacgagcttggccacaaactcattctaataggcgtccggagctgc
acggaagaagaattgcaatttgcggaggagggagggataaaattctacacttctttcgat
gtgatcaaaaagggaatggccgcgattctcaaagagatagaaggtgaaatttcggacaga
gtgtatctctctgtagatgtggatgctttcgatccagcatacgctccgggtgtttccacg
ccggagccttttggtataacacccttcgactacctcgcatttctggaaaagtttgcagac
agaattgtcgggatggatgtagttgaagtggttccggattcagaaaaggtaacacaaatt
cttgcagcaaaactcgtggtggaattcattgctcgtaaacacacttcttcctttttccgg
tga

DBGET integrated database retrieval system