KEGG   Archaeoglobus veneficus: Arcve_1402Help
Entry
Arcve_1402        CDS       T01451                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ave  Archaeoglobus veneficus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcve_1402
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Arcve_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1246616..1247401
Genome map
AA seq 261 aa AA seqDB search
MAKENPQNKKVGVSLRVAVFRPKEHIEETAKVLQKEGFEVVAAPFLKTVVSEEGVEKLKK
AEFEVAIITSQTAAKIAAKNIPLQGKRVIAIGKKTASVLSNAGVNSEMPSKFDSKSIVEE
FAEKLRGKKVAILRSDKGDPVLLNLKNYAEVEEIVLYRIEEEHGKEQLEVLEKVARGELD
AAIFSSRMMVHSFMKLADKAGMLKDVIGGLSKMHVIAIGPPTARALKEYDITPLMPEEYT
FEGVMKLLRSLRAERGQQRKQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaatccacaaaataaaaaggttggtgtaagcttgagggttgcagtattc
agaccaaaagagcatattgaagaaacggcaaaggttctgcaaaaggagggttttgaggta
gtagcggctccatttctcaaaacggtggtcagtgaggagggtgtcgagaagctgaagaaa
gcagagttcgaagttgcgattataacaagtcagactgctgcaaaaatcgcagcaaaaaac
atacctctgcaggggaagagggtgattgcaataggcaaaaaaacagcatcagttctgagc
aacgctggtgtaaattccgaaatgccttctaagtttgattcaaagagtattgtggaagag
ttcgccgaaaagctgagaggaaagaaggtagccatactcagaagtgacaagggtgacccg
gtcttgctgaacctgaagaactacgctgaggtggaggagatagttctgtacagaatcgag
gaagagcacggcaaagagcagcttgaagttcttgagaaagttgcgaggggagaactcgat
gctgccattttctcgagcagaatgatggtgcacagctttatgaagcttgcagataaagca
ggcatgcttaaagacgtgataggggggctcagcaaaatgcacgtgatagccataggtccg
cccacagcaagagccctgaaagaatacgacattactcctctgatgcccgaagagtacacg
ttcgagggcgtaatgaagctgctccgcagccttagagccgagcgtggccagcagcgaaag
caataa

DBGET integrated database retrieval system