KEGG   Archaeoglobus veneficus: Arcve_1410Help
Entry
Arcve_1410        CDS       T01451                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcve_1410
   01230 Biosynthesis of amino acids
    Arcve_1410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_1410
   00051 Fructose and mannose metabolism
    Arcve_1410
   00562 Inositol phosphate metabolism
    Arcve_1410
Enzymes [BR:ave01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arcve_1410
Exosome [BR:ave04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arcve_1410
  Exosomal proteins of bladder cancer cells
   Arcve_1410
  Exosomal proteins of melanoma cells
   Arcve_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1253206..1253958)
Genome map
AA seq 250 aa AA seqDB search
MLSVVCSFFHGDNPNWGLEKIKFPTKKRKIMGVVIINFKAYREGSGKQALELAKIAENVA
SRVDDYIAIAPPTIDLAEIINAVSIDVYAQHVDAVDFGSHTGRITAEMVKEKGAKGSLIN
HSERRLRLADIDFLVSKFKELGLVSIVCTNNVATTAAAAALNPDYVAVEPPELIGSGIPV
SKAEPETVENSVKAAKDVNPNVKVLCGAGIGRHEDYVTALDLGADGVLLASGIVKAKDPK
AALEELVGLR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgctttcagtggtctgtagcttctttcacggagataatcctaattggggactcgaaaag
attaaatttcccacgaaaaaaagaaaaatcatgggcgttgtaataatcaattttaaggcc
tatagagagggctcgggaaagcaggccctcgagcttgcgaagatagctgaaaacgttgcc
agcagggttgacgattatatagcaattgctcctccgactattgacctcgcagagatcata
aacgccgtctcaattgacgtttacgctcagcacgttgacgctgtggattttggaagccac
acgggcaggataacggctgaaatggtgaaggaaaaaggagctaaggggagcctgataaat
catagcgagcgcaggctcaggcttgcagatatagacttcctcgtttcgaagtttaaggag
ctcggcctcgtctccattgtttgcacgaacaatgtcgccacgacggctgctgctgcagcc
ttgaacccggattacgttgccgtcgagccaccagagctcattggttcaggcatacccgtt
tcgaaggcagagccggaaaccgttgagaactcggtgaaggctgccaaggacgtcaacccc
aacgtcaaagtgctgtgtggtgctggtataggcaggcacgaggactatgtaacagccctc
gatttaggggctgacggcgttctgcttgcaagcgggattgtaaaggcgaaggatcccaag
gccgcccttgaagagctcgttggactcagataa

DBGET integrated database retrieval system