KEGG   Archaeoglobus veneficus: Arcve_1544Help
Entry
Arcve_1544        CDS       T01451                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcve_1544
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_1544
   00020 Citrate cycle (TCA cycle)
    Arcve_1544
   00620 Pyruvate metabolism
    Arcve_1544
   00640 Propanoate metabolism
    Arcve_1544
   00650 Butanoate metabolism
    Arcve_1544
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcve_1544
   00680 Methane metabolism
    Arcve_1544
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcve_1544
Enzymes [BR:ave01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcve_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1376937..1377191
Genome map
AA seq 84 aa AA seqDB search
MLKIDCLLAKPSKGSAGKTGLWRTFKPIYNPEKCNHCLLCWLYCPENAIEVNDEEVKIDY
EYCKGCGICAKICPKKALEMEEEE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaagatagactgcttgctggcaaaaccttcaaaggggtctgcaggcaaaaccgga
ctgtggaggacgttcaaaccaatatacaaccctgaaaaatgcaaccactgtctgctctgc
tggctttactgtcccgaaaacgcaatagaggtcaacgatgaagaggtaaagatcgactat
gagtactgtaagggctgcggaatatgtgcaaagatatgtcccaagaaagcattagaaatg
gaggaggaagaatga

DBGET integrated database retrieval system