KEGG   Archaeoglobus veneficus: Arcve_1795Help
Entry
Arcve_1795        CDS       T01451                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00860  Porphyrin and chlorophyll metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcve_1795
Enzymes [BR:ave01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Arcve_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 VWA MCM AAA_16 AAA_29 AAA_22 VWA_CoxE DUF815 Sigma54_activat Mg_chelatase_C AAA AAA_23 TsaE AAA_18 AAA_7 NACHT AAA_25 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AEA47791
JGI: Arcve_1795
UniProt: F2KQY5
Position
complement(1599520..1601406)
Genome map
AA seq 628 aa AA seqDB search
MRVFPFAAIVGQEKAKLALLCNAVNPAIGGVLLSGDKGTGKSTLVRALADVLPEIDVVKG
CPFNCNPYNELEMCEACLQDKKGGRIEVESRKMRVVDLPLSATVDRLVGTLDIQKALKEG
IRALQPGLLAEANRNILYIDEVNLLDDYIADILLDAAAMGWNVVEREGVSVRHPARFILV
GSMNPEEGELRPQILDRFGLYVSVEGSSSVEERIEIVKRVEEFQTDPEKFCRKYEGERSK
IRESIIRAREILGEVEMDDDLLKLLSETIVEQGIRTHRAEIVTVRTAKAIAALDGRKKVN
LEDLKKAMELALPHRLKSKPFDTPPPPKIEKEKQDNKNKVRDKENKKESQGKQHPHEHKQ
NNSNADGNAKGNATSKYDAASVDVDLSKGGVSTAKRASRGSRDERATVIGHPHGYPISSV
PGVASDVDIVATIRTAAMNGRRQICDEDIRVRVRKVKLPRLTVIMLDASGSMAAMRRIRI
AKGVAAKLIENSYVKRDSLALITFRGHAAEVLVPPTRRYSGVMDALHNVVIGGRTPLSSA
LQTLLVLARSFRLKNRDSIVKGVLITDGKANTPLYGKSIKEELQMLASAIKKSGIKLEIY
DSRTRAIDPAPSYIDFLSHALDAPVYRV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgagagtttttccattcgctgcaatagtagggcaggagaaagcaaagcttgctctcctg
tgcaacgctgttaacccagcaatcggcggagttctgctctccggagacaagggaacgggc
aagtcaaccctcgtaagagctctggcagacgttcttcccgaaatagatgttgtgaaaggt
tgtcctttcaactgcaacccttataacgaactcgagatgtgcgaagcgtgcctgcaggat
aagaaaggaggtagaatcgaagtcgaaagcaggaagatgcgagtcgttgatctgccatta
agcgccaccgttgatagacttgttggaacgcttgatatccagaaagcccttaaggaggga
atcagagctttacagcccggcttgcttgcagaggcgaacagaaacatactctacatcgac
gaagttaaccttctcgacgactacatagccgacattttgcttgacgctgctgccatgggc
tggaatgtcgttgagagggaaggtgtatcggtgaggcacccagcacgctttatccttgtc
ggcagcatgaaccctgaggagggtgagttaaggccgcagatactcgacagatttggctta
tatgtcagcgttgaaggttcaagcagtgttgaagaaagaattgaaattgtaaagagggtc
gaggagttccagaccgacccggagaagttctgcagaaagtacgagggagagcggagtaaa
atcagagagtcgataatcagggcgagagagattcttggcgaggtagagatggatgacgac
ttgctgaagctcctttccgagactatagtcgaacagggcataaggacccacagggccgag
atagtgacagtaaggactgcgaaggcaatagcagcactcgatgggaggaagaaggtaaat
ctggaagacttaaagaaggccatggagcttgccctgccacaccgtctgaagtcaaaaccc
ttcgacacacctcctcccccaaaaatagagaaggagaagcaggataataaaaacaaggtc
agggacaaagagaacaaaaaagagagccagggcaagcagcacccccacgaacataagcaa
aacaacagcaacgctgacggcaacgcaaaaggtaatgcaacaagcaagtatgatgcggca
agcgttgacgtagacctctccaagggtggtgtcagcacagcaaagagagcttcaagaggc
tcgagggatgaaagggccacagttataggtcacccccatggttacccgatttcgagcgtt
cctggagtagccagtgacgttgacatcgttgcgacaataaggactgctgcgatgaacgga
agaaggcagatatgcgatgaggacatcagagttagagttagaaaggtgaaactgccgagg
cttacggttatcatgctcgatgcgagcggaagtatggcagcaatgcggagaattaggatt
gcgaaaggtgttgctgcgaaactcattgaaaacagctatgtgaagagagattccctcgct
ttaattaccttcaggggacacgcagcggaagtgctcgtgcctccaacgaggaggtactcg
ggcgtgatggatgcgctgcataatgttgtcataggagggagaacacccctttcctcagcc
cttcagacactcctcgtccttgcgagaagcttcaggctgaagaacagagattccatcgtt
aagggagttctgattacggacggaaaagcgaacacgccgctgtacggaaaatcaattaaa
gaggagctccagatgctcgcatccgccataaagaagagcggaattaagcttgagatatac
gacagcaggacaagagcaatcgatccggccccgtcgtacattgactttctctcccacgcc
ttagacgctccggtttacagggtttag

DBGET integrated database retrieval system