KEGG   Archaeoglobus veneficus: Arcve_1814Help
Entry
Arcve_1814        CDS       T01451                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ave  Archaeoglobus veneficus
Brite
Enzymes [BR:ave01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Arcve_1814
Transfer RNA biogenesis [BR:ave03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Arcve_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1616937..1618574)
Genome map
AA seq 545 aa AA seqDB search
MDTRAASKSSEYTKACIEIADAILELEPRCKEEIAKIKKEISRKYRLPALPADPDILSAF
RERFGECNELVQLKSLLRLKPVRTISGVAVVSVMTSPAPCPHGKCVPCPGGVEIGTPQSY
IGLEPAAQRGRQHGYNAFKQVSARLKELSEIGHDVDKVEIIVMGGTFPAREKDYRDRFIL
DIFNALNCFDSRAKPESDLEKAKRKNEKAKARCVGLTIETRPDFSKREHILEMLRYGATK
VELGVQSVYDDVLNLIRRGHSVADTIEATKLLKDSAFKVGYHVMPGLPGSDFDRDVEMFK
ELFSNESFKPDYLKIYPTLVVEGTELYEWWKAGEYRPYTTEEVVELIARAKRYLPEWVRV
QRIQRDIPVNRAIGLEKGNIRQLVHEKLKEYGYECRCIRCREVGHRLRKLGVKLSSDEIE
RQADLVVRKYKASKGVEYFISYELPDYDALVGFIRLRFPHEPFVDVLRDTALVRELHVYG
KTVPIGGRDTEAFQHRGFGEKLLREAEEIAKQEYDRIAVISGVGVRDYYRRLGYRKRFEY
MVKKL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtggataccagagcagcgagcaaatccagcgaatacacaaaggcttgcatcgagatagct
gatgctatcctcgaactcgaacccagatgtaaagaagagatcgcgaaaatcaagaaggaa
atcagcaggaagtacaggctgcctgcattaccagcagatcccgacatcctctctgcgttc
agggagagatttggtgaatgcaatgaactcgttcagctaaagtcacttctccgtctcaag
cctgtaaggacgataagtggagtcgctgtagtctccgtaatgacctctcccgccccctgc
ccccacggtaaatgtgttccatgccccggaggggttgaaataggcacacctcagagttat
attggcttggaacctgctgcgcagcgtggcaggcagcatggctacaacgcgtttaagcag
gtgagcgcaaggctgaaagagctctctgaaatcggacacgacgttgataaagtagagata
atagtcatgggcggtaccttccccgcaagggagaaggactacagagacaggttcatactc
gacattttcaacgccctgaactgctttgacagccgtgcaaagcctgaaagtgacctggag
aaggcgaagaggaagaacgaaaaagccaaagcgaggtgcgtaggcctaacaatagagacc
cgtcccgatttctcgaagcgagaacacattttggagatgctccgctatggggcaacgaaa
gtcgagctcggtgttcagagtgtttacgacgacgtactcaatttgatcaggagaggtcat
agtgttgccgacacaatcgaagccacgaaactgcttaaagattcagccttcaaagtgggc
taccacgtcatgccgggactgccgggtagcgacttcgatagagacgttgagatgttcaaa
gagctcttctcaaacgagagcttcaagcccgactacctcaaaatctatccaacgctcgtt
gttgaaggaacagaactctacgagtggtggaaagccggtgaatacaggccttacactacc
gaggaagttgtcgagctcatagccagagcaaagcgctatctgccagagtgggtgagggtg
cagagaatccagcgcgatattcccgtcaatcgtgcaataggtctcgaaaaaggcaacata
aggcagcttgtacatgaaaagctgaaggagtacggctacgagtgcagatgcattcgctgc
cgggaagtggggcacaggctgagaaagctcggagttaaactttcaagcgacgaaatagaa
agacaggcagatctcgttgtgaggaagtacaaagcatcgaaaggtgtagagtacttcata
tcctacgagctgcccgattacgatgcactcgtcgggttcataaggctgaggtttccacat
gagccgttcgtagacgtgcttagggatactgctcttgttagagagctgcatgtctacgga
aagacagttccaattggaggcagggatactgaagctttccagcaccgtggctttggagaa
aagctgctcagagaggctgaggaaatcgcaaagcaggagtacgacaggatagcagttata
agtggcgttggtgtcagagactactacagaaggctcgggtacagaaagaggttcgagtac
atggttaaaaagctgtag

DBGET integrated database retrieval system