KEGG   Archaeoglobus veneficus: Arcve_1850Help
Entry
Arcve_1850        CDS       T01451                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ave  Archaeoglobus veneficus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arcve_1850
Enzymes [BR:ave01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Arcve_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1650701..1651621)
Genome map
AA seq 306 aa AA seqDB search
MGRLGSLAEVAGFGALNVDKLFLVDRIPARDEEGFVIDVKIAPGGSAANTIVGLSRLGVK
TVFVGKVGSDSEGEFLLCDLRNEGVDVSSVKVSEGRSGCAMVFVDPSGHRAILVDPGVND
EVDFEEINVEALSAEAIHMTSFVCKSSDKPFEAQKKLATFFDTVSLDPGTLYAERADVWE
LISKTTIFLPSVAEIEKITGADYRRGAEKVMAHGVKIVAVKLGEKGCYVTDGRKEFHIPA
LKVSVADTTGAGDAFNAGFLYAYLRGYDLDVCGVAGNYVAAKCVEKLGARDGLPSERDVE
EYLSGL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggggaggctgggaagcttggctgaggttgcaggcttcggcgctttgaacgttgacaag
ctatttcttgtggacagaattcctgcaagagatgaggagggatttgtaatcgacgtgaaa
atagctccggggggttctgctgctaatactatagttggcctttcgaggcttggtgtgaag
acggtctttgttggaaaggtgggaagcgatagcgagggtgagtttttgctctgcgacctc
agaaacgagggtgtcgatgtatcgagtgtaaaagtttcggaaggtagaagcgggtgtgca
atggtctttgttgatccatcaggtcatagagcgatactcgtcgatccgggcgtcaacgat
gaggttgattttgaggaaatcaacgtagaagcgctgagcgctgaagccatccacatgact
tcttttgtttgcaaaagcagcgacaaacccttcgaagcgcagaaaaagctggcaacgttt
ttcgataccgtcagcctcgatccaggcacactttacgctgaaagagcggacgtatgggaa
ctgatcagtaaaactacaatcttccttccgagtgtggccgagatagagaagataaccgga
gcagactacagacggggggctgaaaaggtaatggcccatggggttaaaatcgttgcagtc
aagctcggtgaaaagggctgctacgtcacggatgggaggaaagagtttcacataccagcc
ctgaaggtcagtgttgcagacacaaccggagcaggggatgcattcaacgcaggctttctc
tacgcgtacctcaggggatatgacctcgacgtttgtggtgttgcaggaaactatgtggca
gcgaagtgtgttgagaagttaggggcaagagacggcctcccttcggagagggatgtcgaa
gagtacctgtcaggactttag

DBGET integrated database retrieval system