KEGG   Archaeoglobus veneficus: Arcve_2030Help
Entry
Arcve_2030        CDS       T01451                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ave  Archaeoglobus veneficus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcve_2030
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcve_2030
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arcve_2030
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arcve_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1804152..1804916)
Genome map
AA seq 254 aa AA seqDB search
MVFEIETPWLVTFITAGDPHPKLTLDFMLALEKYSDVIELGIPFSDPVADGPTIQKANYR
ALKAGTKVSDVFSIVRQFREHSDKPVVLMTYYNPVYAKGVDEFVKLAADAGVSGMIVVDL
PLEESGEYLAACEKHGIDTVFLAAPNTPDERLRAIDEASSAFVYLISLYGTTGAREKIPP
LAFDLLKRAKRICTKPVCVGFGVSKREHVEELVKAGADGVVVGSALVKIIEEYGENAAER
LEEITRELKRGCKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggtgttcgaaatcgaaactccctggctcgttacgttcattacagctggcgatcctcat
ccaaagcttacactggacttcatgctggctctggagaagtattcggacgtgatagaactg
ggcattccattcagtgatcccgtggccgacggcccaacaattcagaaagcaaactacaga
gcgctgaaagccggaacaaaggtttcagacgtcttctcgatagtcaggcagttcagggaa
cactccgataagccggtcgtgctgatgacgtactacaaccccgtttatgcaaagggcgtt
gacgagttcgttaagctcgcagccgatgctggggtaagcggaatgatcgtcgtggattta
cctcttgaggaaagcggtgagtatcttgccgcatgtgaaaagcacggcattgatactgta
tttcttgcggctccgaacacgcctgacgagaggctgagggcgatagacgaggcaagttcg
gctttcgtttacctgatatctttgtatggcacaacgggggcgagggagaagattcctccg
ctggcttttgacctgttaaagagggcaaagcgaatatgtacgaagcctgtctgtgtcggc
tttggcgtttcaaagagagagcacgtggaggagctcgttaaggctggagctgatggcgtt
gtggttgggagtgccctcgttaaaataatagaggaatatggagaaaacgctgcggagaga
cttgaagagattacaagggagcttaagaggggttgtaagggttga

DBGET integrated database retrieval system