KEGG   Archaeoglobus veneficus: Arcve_2095Help
Entry
Arcve_2095        CDS       T01451                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ave  Archaeoglobus veneficus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ave00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1850678..1852195
Genome map
AA seq 505 aa AA seqDB search
MKFRVKLIPVRMDRSSAIMSQEDAEELGVLVGDRVKLVFGKKSVIADVQIATGLIERGEI
GICRTITDYLEIEDGGEVELYPVSKPASVEYIRKKMDGHKLTKEEIFAIIKDIVNNALNE
IELSAFVLSDYFHGMDFDEIEWTTRAMIDTGETLTFERGIVVDKHSIGGVPGNKISLLIV
PIIAASGLLIPKTASRAITSASGTADTMEVLANVSLSVDEIKEITERVGGVIAWGGATNI
APADDKIIRVEYPLSIDPKPQLLASVMAKKGAIGAKHVVIDIPVGAGSKVPTVEKGRELA
NDFVELGRRLGLNVTCVLTYGGQPVGRTVGPALEAWEALKALENAKPPRSLVEKALGVAG
TLLEMAGITVNGIEHARKILESGKALEKFREIVEAQGGDPNIKSDDVPIGDKTYQFTSPI
DGAIAHVDNKRIVKVARAAGAPKDKGAGIMLHKKGGQHVKVGDPLFTIYAEKEWKLDRAV
ELAMREPPVVVSGMVLEKYPSYRYI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcagggtaaagctaattccagtcagaatggatcgctcatcggcaataatgagt
caggaggatgccgaggagctcggagtcctcgtaggcgatagagtcaagctcgtttttggt
aaaaaatctgttatcgctgatgtgcaaatcgcaacaggtctcattgagaggggtgaaatc
ggaatatgcaggacgataacagactatctcgaaattgaagatggtggggaagtagaactt
tatccagtttcgaagcccgccagcgtcgagtacataaggaagaaaatggacgggcacaag
ctgacaaaggaggagatattcgcgataatcaaggacattgtaaacaacgctctgaacgaa
atcgagctttcggcctttgttctttcagactacttccacgggatggatttcgatgagatt
gagtggacgacaagggcgatgatagacaccggtgagacgctaacgtttgaaaggggaata
gtcgttgacaagcacagcattggcggcgttcccggcaacaagatttctctcctcatcgtt
cccattattgcggcaagtggattgctcattccaaagactgcaagcagagccatcacttct
gcgagcggtactgccgacacaatggaggtacttgcaaacgtcagcctcagcgttgacgag
ataaaggagatcaccgagagagttggcggagtgatcgcgtggggtggtgcaacaaatata
gcccctgcggacgacaagataatcagggtcgagtaccctctatccatagatcctaagccc
cagcttcttgcgagtgttatggccaagaagggggctataggtgccaagcacgtggtaatc
gacattcctgtcggagcgggctcgaaggttccgacggtggagaagggaagagagcttgcc
aatgatttcgtagaacttggaagaagactcggccttaatgttacgtgcgttctcacctac
ggcggtcagcccgttggaaggacagttgggcccgcgctcgaagcatgggaagctttaaag
gctctcgaaaatgcgaaaccaccaagaagtctggttgagaaggcactcggtgttgccggc
acgttgctcgaaatggcgggcataactgttaatggaatagaacacgcaagaaagatactc
gagtctggaaaagctcttgagaagttcagagagatagtggaagcccagggaggggaccca
aacataaagtccgacgacgttcctataggggacaagacataccagttcacgtctccaata
gatggtgctattgcgcatgtggataacaagagaatagttaaggttgcaagggctgctgga
gctccgaaggataagggggcaggtattatgctgcacaagaagggtggccagcacgtgaag
gttggagaccccctgtttacaatttacgctgagaaggagtggaagctcgacagggcagta
gagcttgcgatgcgcgaacctcccgtggttgtatcaggaatggttctcgagaagtaccca
tcttacagatacatatga

DBGET integrated database retrieval system