KEGG   Agrobacterium vitis: Avi_0020Help
Entry
Avi_0020          CDS       T00851                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
avi  Agrobacterium vitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Avi_0020 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avi_0020 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avi_0020 (trpB)
Enzymes [BR:avi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Avi_0020 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:15199..16419
Genome map
AA seq 406 aa AA seqDB search
MNQNPIPNSFRSGPDEDGRFGIFGGRFVAETLMPLILDLQAEWENAKTDPSFKAELDHLN
THYTGRPSPLYFAERLTAELGGAKIYFKRDELNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCIVYMGATDVERQAPNVFRMKLLGAEVRPVSSGHGTLKD
AMNEALRDWVTNVDETYYMIGTAAGPHPYPEMVREFQSVIGKESREQMMAAEGRLPDMLV
AAVGGGSNAIGLFHPFLDDESVRMIGVEAGGKGLDGNEHCASLTAGSPGVLHGNRTYLLQ
DSDGQIKDGHSISAGLDYPGIGPEHSWLKDIGRVEYVPIMDTEALEAFQLLTRTEGIIPA
LEPSHALAEVMKRAPKMGKDEIILMNLCGRGDKDIFTVGKILGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagaacccaattccgaattccttccggtccgggccggatgaagatggtcgtttc
ggcattttcggaggccgcttcgtggccgaaaccttgatgccgctgatcctggatctgcag
gcggaatgggaaaatgccaagaccgaccccagcttcaaggctgaactcgatcacctcaac
acccattataccgggcgtccgagcccgctctatttcgccgagcggctgacggcggagctt
ggtggcgccaagatctatttcaagcgcgacgagttgaaccataccggttcgcacaagatc
aacaattgtctcggccagatcctgctggccaagcgcatgggcaagacccggattatcgcc
gagaccggcgctggccagcacggcgtggcctcggccaccgtcgcggctcgtttcggtctg
ccctgcatcgtctatatgggtgccactgatgtggagcgccaggcaccgaacgtcttccgc
atgaagctgctcggtgcggaagtccgcccggtgagttcagggcatggaaccttgaaggat
gcgatgaacgaggccctgcgcgactgggtcaccaatgtcgatgagacctactacatgatc
ggcacggctgccggtccgcatccctatccggaaatggtccgtgaattccagtcggtgatc
ggcaaggaatcccgcgagcagatgatggctgccgaaggccgcctgccggatatgctggtg
gcagctgtcggcggtggctccaatgccattggcctgttccatccgttcctcgatgatgag
agcgtgcggatgatcggtgtcgaggctggcggcaaggggcttgatggcaatgagcattgc
gcctcgctgaccgcaggctcccctggcgtcctgcatggcaaccgcacctatctgctgcaa
gacagcgacgggcagatcaaggatggccattcgatttcggccgggcttgattatccgggt
atcggtccggaacattcctggttgaaggatatcggccgggtggaatatgtgccgatcatg
gataccgaagcgctggaggctttccagcttctgacccgcaccgaaggcattattccggct
ctcgaacccagccacgccctggccgaggtgatgaagcgcgctccgaaaatgggcaaggac
gagatcatcctgatgaacctttgcggacgcggcgacaaggacatctttacggtcggcaag
attctgggaatggggctctga

DBGET integrated database retrieval system