KEGG   Agrobacterium vitis: Avi_0021Help
Entry
Avi_0021          CDS       T00851                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
avi  Agrobacterium vitis
Pathway
avi00260  Glycine, serine and threonine metabolism
avi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01130  Biosynthesis of antibiotics
avi01230  Biosynthesis of amino acids
Module
avi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avi_0021 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avi_0021 (trpA)
Enzymes [BR:avi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Avi_0021 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth HMGL-like PcrB
Motif
Other DBs
NCBI-ProteinID: ACM34987
UniProt: B9JXV7
Position
1:16421..17260
Genome map
AA seq 279 aa AA seqDB search
MTQRMDKRFADLKEEGRPALVTYFMGGDPDFETSLAIMKALPQAGADVIELGMPFSDPMA
DGPAIQMAGQRALKAGQTLVKTLDMAREFRKGDQATPIVMMGYYNPIYVYGVEKFLDDAL
DAGIDGLIVVDLPPEMDDELCLPARKRDINFIRLATPTTDEKRLPMVLQNTSGFVYYVSM
NGITGSALPDPSKVAGAVGRIKAHTDLPICVGFGVKTAEHARLIGASADGVVVGTAIVNQ
VALSLTKDDKATADTVQSVVTLVRGLASGVQTARLAAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgtatggacaaacggttcgccgatctgaaggaagagggccgtccggctctc
gtcacttatttcatgggcggcgatccggatttcgaaacgtcgctcgccatcatgaaggcc
ttgccgcaggctggtgccgatgtgattgagcttggcatgccgttttccgacccgatggcc
gatggtcctgccattcaaatggccggtcagcgcgccctgaaggccggtcagaccctggta
aaaaccctggatatggcgcgggaattccgcaaaggcgatcaggctacgccgatcgtcatg
atggggtattacaatccgatctatgtctatggcgtcgaaaaattcctggatgatgcgctg
gacgcgggcattgacggtttgattgtcgtcgatcttccgccggaaatggacgatgaattg
tgcctgccagcccgcaagcgcgatatcaatttcattcgtctggcgacaccgactacggat
gagaagcgcctgccgatggtgctgcaaaatacctctggattcgtctattatgtatcgatg
aacggcattacaggctcggctttgcccgatccgtccaaggttgccggtgccgtcgggcgg
atcaaggcccataccgatctgccgatctgcgttggcttcggcgtgaagacggcggaacat
gcaaggctgattggggccagcgccgatggcgtcgtggtcggtacggccattgtcaatcag
gtcgcattgagcctgaccaaggatgataaggcgacggcggatacggtgcaatcggtggta
accctagtgcgtgggctggcaagcggcgtccagactgcccggcttgcggctgcgcaatag

DBGET integrated database retrieval system