KEGG   Agrobacterium vitis: Avi_0021Help
Entry
Avi_0021          CDS       T00851                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
avi  Agrobacterium vitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Avi_0021 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avi_0021 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avi_0021 (trpA)
Enzymes [BR:avi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Avi_0021 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:16421..17260
Genome map
AA seq 279 aa AA seqDB search
MTQRMDKRFADLKEEGRPALVTYFMGGDPDFETSLAIMKALPQAGADVIELGMPFSDPMA
DGPAIQMAGQRALKAGQTLVKTLDMAREFRKGDQATPIVMMGYYNPIYVYGVEKFLDDAL
DAGIDGLIVVDLPPEMDDELCLPARKRDINFIRLATPTTDEKRLPMVLQNTSGFVYYVSM
NGITGSALPDPSKVAGAVGRIKAHTDLPICVGFGVKTAEHARLIGASADGVVVGTAIVNQ
VALSLTKDDKATADTVQSVVTLVRGLASGVQTARLAAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgtatggacaaacggttcgccgatctgaaggaagagggccgtccggctctc
gtcacttatttcatgggcggcgatccggatttcgaaacgtcgctcgccatcatgaaggcc
ttgccgcaggctggtgccgatgtgattgagcttggcatgccgttttccgacccgatggcc
gatggtcctgccattcaaatggccggtcagcgcgccctgaaggccggtcagaccctggta
aaaaccctggatatggcgcgggaattccgcaaaggcgatcaggctacgccgatcgtcatg
atggggtattacaatccgatctatgtctatggcgtcgaaaaattcctggatgatgcgctg
gacgcgggcattgacggtttgattgtcgtcgatcttccgccggaaatggacgatgaattg
tgcctgccagcccgcaagcgcgatatcaatttcattcgtctggcgacaccgactacggat
gagaagcgcctgccgatggtgctgcaaaatacctctggattcgtctattatgtatcgatg
aacggcattacaggctcggctttgcccgatccgtccaaggttgccggtgccgtcgggcgg
atcaaggcccataccgatctgccgatctgcgttggcttcggcgtgaagacggcggaacat
gcaaggctgattggggccagcgccgatggcgtcgtggtcggtacggccattgtcaatcag
gtcgcattgagcctgaccaaggatgataaggcgacggcggatacggtgcaatcggtggta
accctagtgcgtgggctggcaagcggcgtccagactgcccggcttgcggctgcgcaatag

DBGET integrated database retrieval system