KEGG   Agrobacterium vitis S4: Avi_0057Help
Entry
Avi_0057          CDS       T00851                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
avi  Agrobacterium vitis S4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:avi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:avi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:avi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:51760..53940
Genome map
AA seq 726 aa AA seqDB search
MARVEQFGLAIEQDLYDFLVSEALPGTGVEPEAFFQHFSSLVHELAPKNRALLAKRDAFQ
AQLDNWYKQNGAPSDLAAYEAFLRDIGYLLPEGPDFSVTTSNVDAEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAISEADGAEKGRGYNPKRGEKVIAWARAFLDQSVPL
AGGRWADVAGLALTDGYLDVTLASGDKTGLMDPSQLAGTFSEDGSVTSYLLRRNGLHVEI
CIDAKGAIGAADKANINDIRMESAITAIMDCEDSVAAVDAEDKILAYSNWLGLMKGDLEE
VVTKGDHVFTRTLNPDLEFTDPQGKPFTVASRSLMLIRNVGHLMTNPAILDRDGAEVPEG
IMDAMVTAVIALHDIGPNGRRKNSRRGSMYVVKPKMHGPEEVAFAVEIFTRVEQALGMEP
NTIKMGIMDEERRTTVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWIAAYENWNVDIGLQCGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHQVDVAGVQAGLKSRTRAKLSDILSVPVASRPNWTPEEIQRELDNNAQG
ILGYVVRWIDQGIGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGVVTEAQVIETLKR
MAAIVDQQNAGDSAYRPMAADFDTSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAT
AIPAKV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgtcgaacagtttggtctggctatcgagcaggatctctatgattttctggtg
agcgaggccttgccggggacaggcgtggagccagaggccttcttccagcatttctccagc
ctcgtgcatgagcttgcgccgaagaatcgcgccctgctggccaagcgcgacgcctttcaa
gcgcagctggacaactggtacaagcaaaacggcgccccctcggatcttgcggcttacgaa
gctttcctgcgcgatatcggctatctcctgccggaagggccggatttttccgtgacgacc
agcaatgtcgacgcggaaatcgcttcgattgccgggccgcagcttgtcgtgcctgtgatg
aatgcccgttatgccctgaatgctgccaatgcgcgctggggttcgctctacgacgcgctc
tacggaacggatgcgatctccgaggccgacggtgccgaaaagggcagggggtataatccc
aaacgtggcgaaaaggttattgcctgggcgcgggctttcctcgatcagtccgtgcctctg
gcgggtggccgctgggcggatgtggcgggccttgcgctgactgatggctatcttgatgta
acgctggcctccggcgacaagaccgggttgatggacccctcgcaactggcggggaccttc
agcgaggatggcagcgtgacctcctatcttctgcgccgcaacggtctgcatgtggaaatc
tgcattgacgccaaaggtgcgattggtgctgccgataaggcgaatatcaatgatatcaga
atggaatcggcgattaccgctatcatggactgcgaggattcggttgccgccgtcgatgct
gaggacaagatcctggcctattccaactggctcggcttgatgaagggcgatctggaggaa
gtggttaccaagggcgatcacgtctttacccgtaccctcaatcctgatctcgaattcacc
gatccgcagggcaagccctttaccgtcgccagccggtcactgatgctgattcgcaatgtc
gggcatctgatgaccaatccggccattctggatcgtgacggtgccgaggtgccggaaggc
attatggatgcgatggtgaccgcggtgatcgcgctgcatgatatcggaccgaatggacgg
cggaagaattcgcgccggggctcaatgtatgtggtgaagccgaaaatgcatgggccggaa
gaagtggcttttgccgtcgaaatttttacccgtgtcgaacaggcgctgggcatggaaccc
aatacgatcaagatgggcattatggatgaggagcgccgtaccacggttaacctcaaggaa
tgcatccgcgccgccaaggaccgggtggtgttcatcaataccggcttcctcgaccgcact
ggcgacgaaatccatacctcgatggaagccgggccgatgattcgcaagggtgacatgaaa
caggccgcctggattgcggcttatgaaaactggaacgtcgatatcggtctgcaatgcggc
ctgtccggccatgcccagattggcaagggcatgtgggccatgccggacctgatggcggcg
atgttggaacagaagatcgctcatccgaaagccggggccaatactgcctgggtcccatca
ccaacggcagctacgctgcatgccacccattatcatcaggtggatgtcgcgggcgtccag
gccggattgaagagccggacgcgggccaagctctccgatatcttgtcggtgccggtggcc
tcccgccccaattggacgccggaagaaatccagcgcgagctggataacaatgcccagggc
attctgggctatgtggtccgctggatcgaccagggcatcggctgctcgaaagtgcctgac
attaacaatgtcgggctgatggaagaccgggcgaccctgcgcatctccgcccaacacatg
gccaactggctgcatcatggcgttgtcaccgaggcgcaggtgatcgaaacactcaaacgg
atggcagccatcgtcgatcagcagaatgcgggtgattcggcctatcgcccgatggctgcc
gatttcgacacctccatcgctttccaggcggcactcgatctggtgttgaagggcagggag
cagccgaacggttataccgaaccggtcctgcaccgccgccgacttgagttgaaggccaca
gcaattccagcaaaagtgtga

DBGET integrated database retrieval system