KEGG   Agrobacterium vitis: Avi_0057Help
Entry
Avi_0057          CDS       T00851                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
avi  Agrobacterium vitis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avi_0057 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Avi_0057 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Avi_0057 (glcB)
Enzymes [BR:avi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Avi_0057 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:51760..53940
Genome map
AA seq 726 aa AA seqDB search
MARVEQFGLAIEQDLYDFLVSEALPGTGVEPEAFFQHFSSLVHELAPKNRALLAKRDAFQ
AQLDNWYKQNGAPSDLAAYEAFLRDIGYLLPEGPDFSVTTSNVDAEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAISEADGAEKGRGYNPKRGEKVIAWARAFLDQSVPL
AGGRWADVAGLALTDGYLDVTLASGDKTGLMDPSQLAGTFSEDGSVTSYLLRRNGLHVEI
CIDAKGAIGAADKANINDIRMESAITAIMDCEDSVAAVDAEDKILAYSNWLGLMKGDLEE
VVTKGDHVFTRTLNPDLEFTDPQGKPFTVASRSLMLIRNVGHLMTNPAILDRDGAEVPEG
IMDAMVTAVIALHDIGPNGRRKNSRRGSMYVVKPKMHGPEEVAFAVEIFTRVEQALGMEP
NTIKMGIMDEERRTTVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWIAAYENWNVDIGLQCGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHQVDVAGVQAGLKSRTRAKLSDILSVPVASRPNWTPEEIQRELDNNAQG
ILGYVVRWIDQGIGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGVVTEAQVIETLKR
MAAIVDQQNAGDSAYRPMAADFDTSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAT
AIPAKV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgtcgaacagtttggtctggctatcgagcaggatctctatgattttctggtg
agcgaggccttgccggggacaggcgtggagccagaggccttcttccagcatttctccagc
ctcgtgcatgagcttgcgccgaagaatcgcgccctgctggccaagcgcgacgcctttcaa
gcgcagctggacaactggtacaagcaaaacggcgccccctcggatcttgcggcttacgaa
gctttcctgcgcgatatcggctatctcctgccggaagggccggatttttccgtgacgacc
agcaatgtcgacgcggaaatcgcttcgattgccgggccgcagcttgtcgtgcctgtgatg
aatgcccgttatgccctgaatgctgccaatgcgcgctggggttcgctctacgacgcgctc
tacggaacggatgcgatctccgaggccgacggtgccgaaaagggcagggggtataatccc
aaacgtggcgaaaaggttattgcctgggcgcgggctttcctcgatcagtccgtgcctctg
gcgggtggccgctgggcggatgtggcgggccttgcgctgactgatggctatcttgatgta
acgctggcctccggcgacaagaccgggttgatggacccctcgcaactggcggggaccttc
agcgaggatggcagcgtgacctcctatcttctgcgccgcaacggtctgcatgtggaaatc
tgcattgacgccaaaggtgcgattggtgctgccgataaggcgaatatcaatgatatcaga
atggaatcggcgattaccgctatcatggactgcgaggattcggttgccgccgtcgatgct
gaggacaagatcctggcctattccaactggctcggcttgatgaagggcgatctggaggaa
gtggttaccaagggcgatcacgtctttacccgtaccctcaatcctgatctcgaattcacc
gatccgcagggcaagccctttaccgtcgccagccggtcactgatgctgattcgcaatgtc
gggcatctgatgaccaatccggccattctggatcgtgacggtgccgaggtgccggaaggc
attatggatgcgatggtgaccgcggtgatcgcgctgcatgatatcggaccgaatggacgg
cggaagaattcgcgccggggctcaatgtatgtggtgaagccgaaaatgcatgggccggaa
gaagtggcttttgccgtcgaaatttttacccgtgtcgaacaggcgctgggcatggaaccc
aatacgatcaagatgggcattatggatgaggagcgccgtaccacggttaacctcaaggaa
tgcatccgcgccgccaaggaccgggtggtgttcatcaataccggcttcctcgaccgcact
ggcgacgaaatccatacctcgatggaagccgggccgatgattcgcaagggtgacatgaaa
caggccgcctggattgcggcttatgaaaactggaacgtcgatatcggtctgcaatgcggc
ctgtccggccatgcccagattggcaagggcatgtgggccatgccggacctgatggcggcg
atgttggaacagaagatcgctcatccgaaagccggggccaatactgcctgggtcccatca
ccaacggcagctacgctgcatgccacccattatcatcaggtggatgtcgcgggcgtccag
gccggattgaagagccggacgcgggccaagctctccgatatcttgtcggtgccggtggcc
tcccgccccaattggacgccggaagaaatccagcgcgagctggataacaatgcccagggc
attctgggctatgtggtccgctggatcgaccagggcatcggctgctcgaaagtgcctgac
attaacaatgtcgggctgatggaagaccgggcgaccctgcgcatctccgcccaacacatg
gccaactggctgcatcatggcgttgtcaccgaggcgcaggtgatcgaaacactcaaacgg
atggcagccatcgtcgatcagcagaatgcgggtgattcggcctatcgcccgatggctgcc
gatttcgacacctccatcgctttccaggcggcactcgatctggtgttgaagggcagggag
cagccgaacggttataccgaaccggtcctgcaccgccgccgacttgagttgaaggccaca
gcaattccagcaaaagtgtga

DBGET integrated database retrieval system