KEGG   Agrobacterium vitis: Avi_0102Help
Entry
Avi_0102          CDS       T00851                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
avi  Agrobacterium vitis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Avi_0102 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Avi_0102 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(98774..99331)
Genome map
AA seq 185 aa AA seqDB search
MNSYMNMGAGALLGTIFVLMSVSIASEGIFHAPTPEKEGYAIVAAEAPAAGGAEGAAPAA
ADKPIAELLASADVKAGEAIFKKCTACHSVDKGGANKVGPNLWGVVDRPVASHEGFAYSA
GMKDFSKGSSEHWTFENLNHFLTAPKKFVAGTAMGFAGIPKEQDRANLLVYLHNQSDNPV
ALPTN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctacatgaatatgggagcaggcgcactgcttggtacgatcttcgtactgatg
tcagtgtccattgcgtcggaggggattttccacgcgccgacccccgaaaaggaaggctat
gccatcgtggctgccgaagcgcctgccgctggcggcgcggaaggtgcggcaccagccgca
gccgacaagccgattgcggaactgctggcatcggcagacgtcaaggctggcgaggccatt
ttcaagaaatgcacagcctgtcatagcgtcgacaagggcggagccaacaaggttggaccc
aacctttggggcgttgtcgaccggcccgtcgccagccatgaaggctttgcctattccgcc
ggtatgaaggatttctccaaaggcagctccgagcactggacctttgaaaacctcaaccac
ttcctgaccgcgccaaagaaattcgtggcgggtacggcgatgggctttgccggtattccc
aaggaacaggaccgcgccaacctgctggtgtatcttcacaaccagtccgacaatccggtg
gcgttaccgaccaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system