KEGG   Agrobacterium vitis: Avi_0156Help
Entry
Avi_0156          CDS       T00851                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
avi  Agrobacterium vitis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:avi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Avi_0156 (recR)
DNA repair and recombination proteins [BR:avi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Avi_0156 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:138537..139142
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKREQLMGPLALAMGEAHAKVKIC
SCCGNVDTIDPCTVCTDERRDQSMIIVVEDVSDLWALERAGAMNVAYHVLGGTLSPLDGV
GPDDLNIKGLIDRVAKGGVREIIIAVNATVEGQTTAHYITDHLAGLGVKTTRLAHGVPVG
GELDYLDEGTLSAALRARTLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcactggtcccgaaatcgaaaaactgatccagctcctggcgaaagtt
ccggggctcggcccccgttcggcccgaagagcagcgctgcatctgatcaagaagcgcgag
caattgatggggccgctggcgctggccatgggcgaggcccacgcgaaggtgaagatctgc
tcctgttgcggcaatgtcgatacgattgatccctgcaccgtctgcactgacgaacggcgc
gaccaatcgatgatcatcgttgtggaggatgtctccgatctctgggcgttggaacgggca
ggcgcgatgaatgtcgcctatcatgtgctgggcggcacgctgtcgccgctcgatggcgtc
gggcctgacgatctcaacatcaagggcctgatcgaccgggtggcaaaaggcggcgtgcgg
gaaatcatcatcgccgttaatgccacggtggaaggccagaccacggcccattatattacc
gatcacctggccgggctaggagtgaaaaccacccggcttgctcatggcgtgcctgtcggc
ggcgaactggactatctggacgagggtacgctctcggcggcgcttcgtgcccgcacgctg
atatag

DBGET integrated database retrieval system