KEGG   Agrobacterium vitis: Avi_0239Help
Entry
Avi_0239          CDS       T00851                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
avi  Agrobacterium vitis
Pathway
avi00010  Glycolysis / Gluconeogenesis
avi00052  Galactose metabolism
avi00500  Starch and sucrose metabolism
avi00520  Amino sugar and nucleotide sugar metabolism
avi00521  Streptomycin biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01200  Carbon metabolism
Module
avi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avi_0239 (glk)
   00052 Galactose metabolism
    Avi_0239 (glk)
   00500 Starch and sucrose metabolism
    Avi_0239 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Avi_0239 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Avi_0239 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Avi_0239 (glk)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Avi_0239 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACM35151
UniProt: B9JYQ5
Position
1:complement(209893..210915)
Genome map
AA seq 340 aa AA seqDB search
MPKPHDNDHMPFPVLVGDIGGTNARFWILMDAHAAPKEFANIHTADFPTIDQAIQDCILD
KSGFQPRSAILAVAGPIKDDEIPLTNCPWVIRPKAMIADLGFDDVLVVNDFEAQALAAAS
LGRNDREPIGPLTETSLNSRVILGPGTGLGVGGLLYTHHTWFPVPGEGGHVDIGPRSDRD
WQIFPHIERIEGRISGEQILCGRGILHLYNAICAADGIEPVWTDPADVTQHALKGNDPVC
VETMTLFVTYLGRIAGDMALVFMARGGVFLSGGISQKIIPLLKSPVFRAAFEDKAPHTEM
MKTIPTFVAIHPQAALSGLAAYARTPSSYGVKHEGRRWQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacctcatgacaatgatcacatgccctttccggttcttgtcggcgatatcggc
ggcaccaatgcgcgcttctggattctcatggatgcccatgctgcgcctaaggaatttgcc
aatattcacacagcggatttcccgaccatcgaccaggccattcaggattgtattctcgac
aaatccggattccagccgcgctcggccatcctggctgtggccggtccgatcaaggatgac
gaaatcccgctgaccaattgcccctgggtcattcgtcccaaggcgatgattgccgatctc
ggctttgacgacgtgcttgttgtcaatgatttcgaagcgcaggcgctggctgctgcctca
ctgggacgcaacgaccgcgaaccgatcggtcccctgaccgaaacctcgctgaactcccgc
gtcattctgggacctggcaccgggctgggtgttggcggtctgctttatacccatcatacc
tggtttccggttcccggcgaaggtggccatgtggatatcggaccgcgcagtgaccgggat
tggcagatttttccgcatatcgaacggatcgaaggccggatttccggcgagcagatcctg
tgcgggcgcggcatcctgcatctctacaatgccatctgcgctgccgatggcattgagcct
gtatggaccgatcccgccgatgtgacccagcatgccctgaagggcaatgatccggtctgc
gtggaaaccatgacactgttcgtgacctatcttggccggattgccggtgatatggctctg
gttttcatggcccgtggcggcgttttcctgtccggcggcatttcgcaaaagatcatcccc
ttgctgaagagcccggtcttccgggccgctttcgaggacaaggcgccgcatacggaaatg
atgaagaccattcccacctttgtcgccattcacccgcaggccgccctttcagggctggca
gcctatgcccgcacgccgtcgagctatggtgtgaagcatgagggccgtcgctggcagcgt
tga

DBGET integrated database retrieval system