KEGG   Agrobacterium vitis: Avi_0265Help
Entry
Avi_0265          CDS       T00851                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
avi  Agrobacterium vitis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Avi_0265 (deoA)
Enzymes [BR:avi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Avi_0265 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:230312..231631
Genome map
AA seq 439 aa AA seqDB search
MQAVEIIRRKRDGEELSSADLQTFIRALSRDELSEGQIAAFAMAVFLRGMSDAETVALTL
AMRDSGTVLSWKTAGRPVADKHSTGGVGDNVSLMLAPMMAACGLAVPMISGRGLGHTGGT
LDKLESIPGYDIAPDASVFHALVEEIGCAIIGQTADLAPADKRLYAVRDVTATVESVPLI
TASILSKKLASGLESLVMDVKFGNGAFMGQIDEARALARSLVAVANGAGTRTSALLTDMN
EPLADCAGNAVEIANAVAFLRGEKAGTRLETVTLALGAEMLVNAGVEPDRNAADIRCRHA
LESGRAAEIFGRMVHGLGGPLDFIDRAGQYLPKAVLDIPVLATASGFISTVATRDIGLAV
IDLGGGRRRASDRIDHSVGFSGLLPVGTAVTKGDVLAVVHAADEASGTRAAQVIAASVAI
GDEALVPGPAVVERLNSQS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgtggagatcattcgccgcaagcgcgacggagaggagctttccagcgccgat
ctccagaccttcatccgcgccttgagccgggatgaactgtcggaagggcagattgccgcc
tttgccatggcggtctttctgcggggcatgagcgatgccgagacggtggcgctgaccttg
gcgatgcgtgacagcggtacggttctgtcgtggaagacggcgggccgtcccgtggctgac
aagcattccaccggcggtgtcggcgacaatgtctcgttgatgctggccccgatgatggcc
gcctgcgggttggctgtgccgatgatttccgggcggggacttggccataccggtgggacg
ctggacaagctggaatcgatacccggctatgatattgcgcccgatgcctcggtcttccat
gccttggtggaggagattggttgcgccatcatcggccagaccgccgacctcgctcccgcc
gacaaacggctttacgcggttcgcgatgtgacggcgacggtggaatccgtgccgttgatc
acggcatccattctgtccaaaaagctcgccagcggattggagagcctggtgatggatgtg
aagttcggcaacggtgccttcatgggccagatcgacgaggcccgggcgctggcgcgctca
ctggtggcggtcgccaatggcgcaggcaccagaacctcggcactgctgaccgatatgaac
gagcctctggcggattgtgcaggcaatgccgtggaaatagccaatgcggtcgccttcctg
agaggtgagaaggcgggaacccggttggagaccgtgacattggcgctcggtgccgagatg
ctggtcaatgccggggttgagccggatcggaacgccgctgacatcaggtgtcgccacgcc
ctggaaagtggtcgggctgccgagattttcggacgtatggtgcatgggctgggcgggccg
ctggatttcatcgacagggctggccaatatctgcccaaggcggtgctggatattccggtt
cttgccacggcatctggcttcatttccacggtcgccacccgcgatatcggccttgcggtg
atcgacctcggcggaggtcgccgacgtgcctcggacaggattgaccattcggttggcttc
agcggcttactgccggtggggaccgctgttaccaaaggcgacgttctggccgtggtccat
gccgccgatgaagccagcggcacccgcgccgcgcaggttattgcggcaagcgttgccatc
ggcgatgaagcgttggtgccgggacctgctgtggttgaacggctcaactctcaatcttga

DBGET integrated database retrieval system