KEGG   Agrobacterium vitis S4: Avi_0474Help
Entry
Avi_0474          CDS       T00851                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
avi  Agrobacterium vitis S4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:avi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:avi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:402014..403228
Genome map
AA seq 404 aa AA seqDB search
MSKHPANSSATDPVDNLQTLIRCPSVTPAEGGALSALAAMLEPLGFTVERMVAREEGTPD
VENLYARLGTEGPHLMFAGHTDVVPVGNEADWTYPPFSAEIAGGELYGRGAVDMKGGIAC
FVAAIARHIESQGAPKGSISFLITGDEEGPSINGTTKLLEWAAAKGERWDACLVGEPTNP
DQLGDMIKIGRRGSLSGEIIVKGVQGHAAYPHLADNPVRGMIKLAEALMHPAFDAGTENF
QPSNLEVTTIDVGNAATNVIPARASAKFNIRFNDTWTAETLRTEIIARLDTASADPLLRP
GRPPIAYELVWADRPSQVFLTRNNALISSLSAAIEKMTGKTPALSTTGGTSDARFIKDYC
PVVEFGLVGQTMHMVDERVAVSDLEALTGIYGAFISSWFTHAGA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagcatccagccaattcatctgccaccgatcccgtcgacaatcttcagaccctg
atccgctgcccctccgtgacgcctgccgagggcggggcgctgtcggcgctggccgccatg
ctggaaccgttgggctttaccgtggaacggatggtggcgcgcgaagagggcacgccggat
gtcgagaacctctatgcccggctgggcacggaggggccgcatctgatgtttgccgggcat
acagatgtggtgcctgtaggcaatgaggcggactggacctatccgccgttttccgccgag
atcgctggaggcgaactttacggacgtggcgcggtcgatatgaagggcggcatcgcctgc
tttgtcgccgccattgcccgccatatcgaaagccaaggcgcgccgaaggggtctatttcc
ttcctgataaccggtgatgaggaaggcccctcgatcaacggcaccaccaaactgctagaa
tgggccgccgccaaaggcgagcgctgggatgcctgcctggtgggcgaaccgaccaatccc
gaccagcttggcgacatgatcaagatcgggcggcgcggctcgctgtcaggcgagatcatc
gtaaagggcgtccagggccatgccgcctatccgcatctggccgacaatccggtgcggggc
atgatcaagcttgcggaagcgctgatgcatccggccttcgatgcgggaacggaaaatttt
cagccttccaatctggaagtcacgacgattgatgtcggtaacgccgccaccaatgtcatt
ccggcccgtgccagcgccaaattcaatatccgctttaacgatacctggaccgccgagacg
ctgcggaccgaaatcattgcccggctcgatacggccagcgccgatccgctgctgcgacca
ggccgcccgccgattgcctatgagctggtctgggccgaccggccaagccaggtgttcctg
acccgcaacaacgcgctgatctcctccttgagtgctgccatcgaaaaaatgaccggtaaa
acgccagccctgtcgacaacagggggtacgtccgacgcccgcttcatcaaggattactgc
ccggtggtggaattcggccttgtcggccagaccatgcatatggtcgatgagcgggttgcc
gtctccgatctggaggcgttgaccggcatatatggcgccttcatcagcagctggtttact
catgccggggcttaa

DBGET integrated database retrieval system