KEGG   Agrobacterium vitis: Avi_0597Help
Entry
Avi_0597          CDS       T00851                                 

Gene name
fadB
Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
avi  Agrobacterium vitis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avi_0597 (fadB)
   01212 Fatty acid metabolism
    Avi_0597 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Avi_0597 (fadB)
   00650 Butanoate metabolism
    Avi_0597 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Avi_0597 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Avi_0597 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Avi_0597 (fadB)
   00310 Lysine degradation
    Avi_0597 (fadB)
   00380 Tryptophan metabolism
    Avi_0597 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Avi_0597 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Avi_0597 (fadB)
   00281 Geraniol degradation
    Avi_0597 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Avi_0597 (fadB)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Avi_0597 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Avi_0597 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Avi_0597 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(509894..512107)
Genome map
AA seq 737 aa AA seqDB search
MTYKNFTVETDADGIALVTWDMPDKSMNVFTMEVMDEIEAIVDATVADAAVKGVVFTSGK
SAFSGGADLSMIRGMFSMVEEERAKDPANAVQKLFDSAGRMSWLWRKIETNGKPWVSAIN
GTCMGGAFELSLSCHGRVVSNGKSVKLALPEVKVGIFPGAGGTQRVPRLANAQDALQMMT
TGQTLTPQRAKAMNLVHQVVEPDQLISAAKQMIKDGLKPVAPWDEKGFKAPGGGIWTPAS
AQLWPAAPAVLRRETSGNYPAALAILKCVYEGLQVPFDTGLRIEQRYFTEIVQTTEAFSM
IRSLFISLQELGKGARRPAGQPKSTLKKVGVVGAGFMGASIAYVTAAAGLPVVLIDRDME
AANKGRSVAEGLVSGAIGKGKMSKEDGEKLLSLITPSDDYSSLSDADLVIEAVFEDRDVK
KAVIEKVEAVLPEGAIFASNTSTLPITGLAKNSKRPADFIGVHFFSPVEKMMLTEVILGK
ETGDKALAVALDYVAAIKKTPIVVNDTRGFFVNRCVLRYMAESYDMLLEGVPPVMIENAA
KFAGMPVGPLSLNDEVAIDLSYKILKATIADLGEKAVDPRHMELVARMVEKEERFGRKNG
KGFYDYPAKPAKKHVWPGLKDFYPQQKPDDVNVKTLQERFLATIALEAARTMEEGIVVDP
READVGSILGFGFAPYTGGALSYIDGMGVKTFVALCERLAKDYGPHFAPTPLLKEMAQKG
ETFYGRFDPYGAAKQAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacctataagaatttcaccgttgagaccgatgcagacggcattgcccttgtcacctgg
gacatgcccgacaagagcatgaatgtcttcaccatggaagtgatggacgaaatcgaagcg
attgtggatgccaccgtcgcggatgccgccgtcaagggcgtggtcttcacatcaggcaaa
tccgccttctccggcggtgccgatctcagcatgatccgcggcatgttttccatggtggag
gaagagcgcgccaaggacccggccaatgccgtgcaaaaactgttcgactccgctggccgg
atgagctggctgtggcgcaagatcgagaccaatggcaagccctgggtctccgccatcaac
ggcacctgcatgggcggcgcgtttgagctgtcgctctcctgccatggccgcgtggtctcc
aacggcaaatcggtgaagctggcgctgccggaagtcaaggttggcatcttccccggcgct
ggcggcacccagcgtgtgccgcgtctggccaatgcccaggacgccctgcaaatgatgacc
accggccagaccctgacgccgcagcgcgccaaggccatgaacctcgtgcatcaggtggtg
gagccggatcagctcatttcggctgcaaagcagatgatcaaggatggcttgaagccggtt
gctccctgggatgaaaagggcttcaaggctcccggcggcggcatctggacaccggcatcg
gcccagctttggccagcggcaccggctgtgctgcgccgtgaaacctccggcaattatccg
gccgctctggcgatcctgaaatgcgtctatgagggcttgcaggtgccgttcgacaccggc
cttcgcatcgaacagcgctatttcaccgaaatcgtccagaccaccgaagccttctcgatg
atccgctcgctgttcatctcgcttcaggagcttggcaagggcgcgcgccgcccggcaggc
cagccgaaaagcaccctcaagaaggttggcgtggttggcgctggtttcatgggcgcatcg
attgcctatgtcactgccgccgccggtctgcccgtagtgctgatcgaccgcgacatggag
gctgccaacaagggcaggtccgtggctgaaggcctggtgtcgggtgcaatcggcaagggc
aagatgagcaaggaagacggcgaaaagctgctgtctctgatcacccccagcgacgattat
tcatcgctgtcggatgctgatctggtgatcgaagcggtgtttgaagaccgcgacgtcaag
aaggccgtgatcgaaaaggttgaggccgtgctgccggaaggggcaatttttgcctccaac
acctcgaccctgccgatcaccggtcttgccaagaactccaagcgtcctgctgatttcatc
ggcgtgcatttcttctcgccggtcgaaaagatgatgctgacggaagtcatcctcggcaag
gagaccggcgacaaggcgctggcggtggctctcgactatgtggcggccatcaagaagacg
ccgattgtcgtcaatgatacccgtggtttcttcgtcaatcgctgcgtactgcgctacatg
gcggaaagctacgacatgctgctggaaggcgtgccgccggtgatgatcgaaaatgccgcg
aaattcgccggcatgccggttggtccgctgtccctcaacgatgaagtggcaatcgatctg
tcctacaagatcctcaaggcgaccattgccgatctcggtgaaaaggccgtggacccgcgc
catatggaactggtggcccgcatggtcgagaaggaagaacgctttggccgcaagaatggc
aagggcttttacgactaccccgccaagcctgccaaaaagcatgtctggccgggcctgaag
gacttttatccgcagcaaaagccggatgacgtcaacgtcaagaccctgcaagagcgtttc
ctggcgaccatcgccctggaagcggcccgcaccatggaagaaggcatcgtggttgacccc
cgcgaagccgatgtcggctctatccttggcttcggctttgccccctataccggcggtgcg
ctgtcctacatcgacggcatgggcgtgaagacattcgtggcactctgcgaacggttggcc
aaggactacggcccgcattttgcaccaacgccgctgctcaaggagatggcgcagaagggc
gagaccttctacgggcggtttgatccctatggggcagccaagcaggcggcctga

DBGET integrated database retrieval system