KEGG   Agrobacterium vitis: Avi_0643Help
Entry
Avi_0643          CDS       T00851                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
avi  Agrobacterium vitis
Pathway
avi00340  Histidine metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01230  Biosynthesis of amino acids
Module
avi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Avi_0643 (hisD)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Avi_0643 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACM35458
UniProt: B9JR45
Position
1:complement(555483..556781)
Genome map
AA seq 432 aa AA seqDB search
MAVWLEQASDDFEARFSAFLTTKREVSEDVNAVVRTIIDDVRARGDAALAEYSHRFDGLD
FTVTPMRVTEAEIDAAFAEVSPELIDALHLAAERIERHHARQMPKDDIYEDAIGVGLGSR
WTAIDAVGLYVPGGTASYPSSVLMNAVPARVAGVPRVVMVVPASGGAINPTVLAAAKIAG
VTEIYRIGGAQAVAALAYGTQTIEPVAKIVGPGNAYVAAAKRHVFGTVGIDMIAGPSEVL
VIADKDNDPDWIAADLLAQAEHDRGAQSILITDSPDFAKAVEAAVERQLKTLSRSETASA
SWQDFGALVIVPNLTAAVPLANRIAAEHLELAVADPDALMAGIRNAGAIFIGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQQLRQLAPAAIALAKSEGLDAH
ARSVAIRLNLEE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtttggcttgagcaggcatcggatgattttgaggcgcggttttccgcatttctc
accaccaagcgggaagtgtccgaggatgtaaacgcagtcgtcagaaccattatcgacgat
gtgcgggcgcgcggcgatgccgccttggcggagtattcgcatcggttcgatgggctggat
ttcacagtgacgcccatgcgcgtcaccgaagctgaaatcgatgcggcctttgccgaggtc
tcgcctgagctgatcgatgcgttgcaccttgccgcagagcgcattgagcgccaccacgcg
cgccagatgcccaaggacgatatctacgaagacgccatcggcgtcggcctcggctcccgc
tggaccgccatcgatgcggttggtctctatgtgccgggcggcacggcaagctatcccagt
tccgtgctgatgaatgccgttccggccagggttgctggggtgccgcgcgtcgtcatggtc
gtgccggcctccggcggtgccatcaatcccacggtgctggctgcggcaaaaattgctggc
gtgacggaaatctaccggatcggtggcgctcaggctgtcgccgcactcgcttacggcacg
caaaccatcgaaccggtcgccaagatcgtcggccccggcaatgcctatgtggccgctgcc
aagcgccatgtgttcggcactgttggcatcgatatgatcgctggcccttcggaagtgctt
gttatcgccgacaaggataatgacccagactggattgccgccgatctgctggcgcaggcg
gaacacgaccggggcgctcaatcgatcctgatcactgacagtccggactttgccaaggcc
gttgaggctgccgtcgagcggcaattgaaaacattgagccgcagcgaaactgccagcgcc
agctggcaggattttggcgcgctggtcattgtcccgaaccttaccgctgccgtgccgctt
gccaaccgcattgccgccgagcatctggaactcgccgtcgccgatcccgatgcgctgatg
gcgggcattcgcaatgctggcgcgatcttcatcggtcgccatacgccggaagtgatcggc
gactatgttggcggctccaaccacgtcctgcccacggcccgttcggcgcggttttcgtca
ggcctgtcggtgctggatttcgtcaagcgcacatcgatattacggctcggcccgcaacag
cttaggcaattggcgccggcagcaattgctttggccaagagcgaggggctggatgcccat
gcacgatccgtcgccatccgactcaatcttgaggaatag

DBGET integrated database retrieval system