KEGG   Agrobacterium vitis: Avi_0816Help
Entry
Avi_0816          CDS       T00851                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00630  Glyoxylate and dicarboxylate metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01200  Carbon metabolism
Module
avi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Avi_0816 (aceA)
Enzymes [BR:avi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Avi_0816 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACM35577
UniProt: B9JRV1
Position
1:complement(699018..700307)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPSAPQGRFDGVERTYSAEDVKRLRGSVDIRYSLAEMGANRLWQLIGQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASSMYPDQSLYPANAAPELAKRINKT
LQRADQIETQEGKGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLTAARLAADVMGTPTLIIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTAEGFYQVRNGIEPCIARAISYAPYCDLIWMETSKPDLEQARKFAEAVHKV
HPGKKLAYNCSPSFNWKKNLDDATIAKYQKELGAMGYKFQFITLAGFHQLNYGMFELARG
YKDRQMSAYSELQQAEFAAEANGYTATKHQREVGTGYFDAVSMAISGGTSSTTAMKESTE
HDQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttacaaactcgttccctccgcgccacaaggccgtttcgatggcgttgag
cggacctattcggcagaggatgtcaagcggctgcgtggctccgtggatatccgctattcg
ctggcagaaatgggggcgaaccggttgtggcagctgatcggccaggaggatttcgtcaat
gcgctgggggcgctatcgggcaatcaggccatgcagatggtgcgcgccgggttgaaggcg
atctacctttccggctggcaggttgccgcggacgccaataccgcgtcctccatgtatccc
gaccaatcgctctaccctgccaatgcggccccggaactggccaagcggatcaacaagacc
ctgcaacgggccgaccagatcgaaacccaggaaggcaagggcctgtcggtcgagacgtgg
tttgcaccgattgttgccgatgcggaagctggttttggcgggccgctcaatgctttcgag
atcatgaaagccttcattgaggcgggtgcggcgggcgtccattacgaagaccagttggcg
tcggagaagaaatgcggccatctgggcggcaaggtgttgatcccgaccgccgcccatatc
cgcaacctgaccgccgcccggcttgccgccgacgtgatgggcacgccaacgctgatcatc
gcccgcaccgatgccgaggccgccaagctgctgacctctgatatcgatgagcgcgaccag
ccttttgtggactatgatgcgggtcgcactgccgaaggcttttaccaggtacgaaacggc
atcgagccctgcattgcccgcgccatttcctatgcgccttattgcgatctgatctggatg
gagacctccaagccggatctggaacaggcccgcaaattcgcggaggccgtgcataaggtg
catccgggcaagaagctggcctataattgctcgccatcctttaactggaaaaagaacctc
gatgacgcgaccattgccaagtaccagaaggaactgggcgccatgggctacaagttccag
ttcatcacgctggcgggcttccatcagctgaactacggcatgtttgaactggcgcgtggc
tacaaggaccggcagatgtccgcctattccgagctgcaacaggcggaatttgccgcagaa
gccaatggctacaccgccaccaagcatcagcgcgaagttggcaccggctatttcgatgcg
gtttccatggcgatttccggtggcacgtcctcaaccacggccatgaaggagtcgaccgaa
catgaccagttccgccctgctgctgaatga

DBGET integrated database retrieval system