KEGG   Agrobacterium vitis: Avi_0914Help
Entry
Avi_0914          CDS       T00851                                 

Definition
MFS permease
Organism
avi  Agrobacterium vitis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:772230..773651
Genome map
AA seq 473 aa AA seqDB search
MNRIVPLILAVALFMENMDSTVIATALPAIANDLGVGPITLKLALTSYMVALAIFIPVSG
WMADKFGAKQIFRAAIGVFIVGSVCCAMSGSLVEFVAARFLQGMGGAMMTPVARLVLLRT
NKREDLVSAIALLTIPGLVGPLAGPPVGGFITTYFTWHWIFLINVPISVLGVVLTTIFLP
EIERVETAPIDWTGFALTSLSAAGVVFGLSVMSLPALPPIVGTAATVIGLLCGVLYIVHA
RRHPAPLLDLTLFRKPAFRAAQIGGTLFRISAGAIPFLMPLMLQLGFGMTPFESGLTTFV
GAIGAISTKFLARRVFAAAGFRSVLIVAGVCGAATTFLNAFFTPQTPHALLMFFLLMAGF
CRSFFFTGTNALGYANIDNNEASQATSIASVLQQISLALGVACAAFVLEISTMLTGGHLD
LADFHVAFAVVAFLSLAAVIPYIFMDKNAGADVSGHRQPLAGGAATAENLSAK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcatcgttccgctcatcctggccgtggccctgttcatggaaaacatggactcc
acggtgattgcgaccgcgctgcccgccattgccaacgatctcggcgtcgggccgatcacg
ctgaaactggctctgacgtcttatatggtggcgcttgccattttcattccggtcagcggc
tggatggcggataaattcggggccaagcaaatcttccgggcggcgattggggtttttatc
gtcgggtccgtttgctgcgcgatgtccggttcgctggtggaattcgtcgccgcccggttt
ttgcaaggcatgggcggcgcgatgatgacgccggtcgcccgtttggttctgctgcgcacc
aacaagcgcgaggatctggtctcggccattgcgctgctgaccattcccggccttgtcggt
ccgctggccgggccgccggtcggtggttttatcaccacctatttcacctggcactggatt
tttctgatcaatgtgccgatcagcgtgctgggtgtcgtcttgacgacaattttcctgccg
gaaatcgagcgggtcgaaaccgcgccgatcgactggaccggatttgccctgacctcgctg
tcggcggcgggcgtcgttttcggcctgtcggtcatgagcctgccagccttgccgccgatt
gtcggtactgccgcaactgttatcggcctgttgtgcggcgttctttatatagtgcatgcc
aggcgccatcctgcaccgcttctggatctcaccctgtttcgcaaaccggcctttcgcgcc
gcccagatcggtgggacgctgtttcggatttcggcgggtgccattccctttctgatgccg
ctgatgctgcaactcggcttcggcatgacaccgtttgaatccgggctgaccacctttgtc
ggcgccattggggcgatcagcaccaaattcctggcgcgccgggtgtttgccgccgccggt
tttcgcagtgtgttgattgtggcgggcgtctgcggcgccgcgaccacctttctcaacgcg
tttttcacgccgcagaccccgcatgcgctgctgatgttcttcctgctgatggctggtttc
tgccgctcgtttttcttcaccggcaccaatgcgctgggctatgccaatatcgacaataac
gaggccagtcaggcaacctcaattgcctcggtgttgcaacagatcagtctggcgctcggc
gttgcttgcgcggccttcgttctggagatcagcaccatgctgaccggtggtcatctggat
cttgccgattttcatgtggcctttgccgtcgtggcgtttttgtcgctggccgcggtcatt
ccctatatctttatggacaagaatgccggtgccgatgtgtccggccatcggcagcccttg
gcaggtggggccgccactgcggaaaaccttagcgccaaataa

DBGET integrated database retrieval system