KEGG   Agrobacterium vitis: Avi_0941Help
Entry
Avi_0941          CDS       T00851                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
avi  Agrobacterium vitis
Pathway
avi00900  Terpenoid backbone biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Avi_0941 (ispE)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Avi_0941 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACM35660
UniProt: B9JSG7
Position
1:complement(790279..791151)
Genome map
AA seq 290 aa AA seqDB search
MTVFREIAAAKINLALHVTGRRDDGYHLLDTLVTFAGHGDVITVEAARQDEFTLSGRFAG
QLQSEDPAGNLVIRARDLLRTATLAKGLPAPSVAISLQKNLPIASGIGGGSADAAATLRA
LQHLWESHLEPAALEDLALKLGADVPMCLASTSLRATGIGEDLTPLPALPRFGLLLGNPL
QAVSTPAIFKAMTRRDNPPIGPLPTLMDQDPWIETLRRLRNDLQPAAETLCPHIAELSRM
IEATGALVTRMSGSGATCFGLYPTYDAAFAAEKALLTARPDWYFQASQTL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtatttcgtgaaattgcagcggcaaagatcaatcttgccctgcatgtcacgggc
agacgggatgatggctaccaccttctcgatacgctcgtgacatttgccggacatggcgac
gtgatcaccgttgaagcggcccgacaggatgaatttaccctgtcggggcgcttcgcaggc
cagcttcagtcggaggatccggctggaaacctggttattcgggcgcgggatctgttgcga
acagccactctggccaagggcctgcctgccccgtccgttgccatctccttacaaaaaaat
ctgccaattgcgtccggcattggtggcggttcagccgatgccgcagccacgctgagggct
ttgcagcacctatgggaaagccatcttgagccagccgccttggaggatctggccctaaag
ctgggagcagatgtgccgatgtgccttgcaagcacatccttgcgcgccacaggcattggc
gaagacctgacacccctgccggccttgccacgctttggcctcctgctcggcaatccgttg
caggcggtgtccacaccagcgatcttcaaggcgatgaccaggcgcgacaatccaccgatt
ggcccgctgccaacgctgatggaccaagacccatggatagagacgctccgccgattgcgt
aatgatctgcaacccgccgccgaaaccttgtgtccgcacattgccgagctttcccggatg
atcgaagcaaccggcgcgcttgtcacccggatgtccggctccggcgccacctgttttggc
ctttaccccacctatgacgctgcatttgccgctgaaaaagcgcttctcacggcgcggccg
gattggtattttcaggcgagccagaccctatag

DBGET integrated database retrieval system