KEGG   Agrobacterium vitis S4: Avi_0956Help
Entry
Avi_0956          CDS       T00851                                 

Gene name
glyS
Definition
glycyl-tRNA synthetase subunit beta
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
avi  Agrobacterium vitis S4
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:avi00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:802014..804308
Genome map
AA seq 764 aa AA seqDB search
MPDLLLELRSEEIPARMQRKAAGDLKKLVTDALVDAGLTYEGAREYWTPRRLVLDIRGLT
ARSADVKEEKKGPSVSAPEKAIEGFLRGAGLASIDQAVVKTDPKKGDFYVAMIDKPGRSA
EEIITEAMPGIIRSFPWPKSMRSGAASMPKGSRYGGIEGKGSESLRWVRPLQSILCTFGS
EHDEVAIIPFDIDGITASNITYGHRFHAPEAITVRRFDDYVSSLEKAKVILDAERRKDII
LHDARDVAFANGLDLVEDEGLLEEVSGLVEYPQVLLGTFEADYLSIPSEIIRLTIKTNQK
CFVTRPIGESEKLSNHFILISNIAAHDGGAEIIHGNGKVVRARLSDALHFWKRDQGNLPD
LETLEASAAKFGLDLKKPLDQRMAKLDALNVTFHAKLGSQGERVARIRDLAKVLAPVVGA
DEALVDRAVVLAKADLRTEAVGEFPELQGLMGRKYATLQGEHESVAAAIEDHYKPQGPSD
RLPEDKVAITVALADKLDTLVWFWAINEKPTGSKDPFALRRAALGDVRILLEKNIRLSLL
DVFAHSLLGRSLTSEEIERIIDAAIYESVAGGAPKDSTSSKYSQEFASVFLGGSLLSFFH
DRLKVYLRDQGARHDIIDAVLTPEADDLLMVARRAEALTAFITSEDGKNLLAGTKRATQL
LAAEEKKGTVVADGVSEALLTLDAEKALYAAIVQATQSAAEAVAKEDFRSAMQALSTLRA
PVDTFFEDVLVNDEDAAIRANRLALLKAIREATGTVADFSKIAG
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatcttctgcttgaacttcgctccgaggaaatccctgcccgcatgcagcgcaag
gcggcgggtgatctgaaaaagctggtcacggatgcacttgtcgatgcgggcctgacctat
gaaggtgcgcgggaatattggacgccgcgccggctggtgctggacattcgcggactgacg
gcccggtctgccgatgtgaaggaagaaaagaaggggccgagcgtgtcggcgccagaaaag
gccatcgagggctttttgcgcggcgcggggctcgcctccatcgatcaggccgtggtcaag
accgatcccaagaagggcgatttctacgtcgcgatgatcgacaagccgggccggtcagcc
gaagagatcattaccgaggcgatgccgggcattatccgcagttttccgtggccgaagtcc
atgcgatcaggtgcggcgtccatgccaaagggttcacgctatggcggcatcgaaggcaag
gggtcggaaagcctgcgctgggtgcggccgctgcaatccattctctgcaccttcggctcc
gagcacgacgaagtggcgatcattcccttcgacatcgacgggatcaccgcctccaacatc
acctatggccaccgtttccacgcgccggaggccatcaccgtgcggcgcttcgacgattat
gtgtcgagcctggaaaaggccaaggtgatccttgatgccgagcggcgcaaggatatcatc
cttcacgacgctcgcgacgtggcctttgccaatgggctggacctggtggaagacgagggt
ctgctggaagaagtgtccggcctggtggaatatccgcaggtcctgcttggcacgtttgag
gccgattatctgtcgatcccctcggaaatcatccggctgaccatcaagaccaaccagaaa
tgcttcgtcacccggccaattggcgagagtgaaaagctctccaaccatttcatcctgatc
tctaacatcgccgcccatgacggcggcgcggaaatcatccacggcaatggcaaggtggtc
cgcgcccgcctgtccgacgccctgcatttctggaagcgtgaccagggcaatctgccggat
ctggaaacgcttgaagcaagcgctgcaaaattcggcctcgacctgaaaaagccgctcgac
cagcggatggccaagctggatgcgctgaacgtgaccttccacgccaagctgggaagccag
ggtgagcgtgtggcccgcatccgcgatttggctaaggttctggctcctgtcgtcggagcc
gatgaagctttggtggaccgcgccgtggtgctggccaaggccgatttgcgcaccgaagcc
gtcggcgaattccccgaactgcaaggcctgatgggccgcaaatatgcgacgcttcagggc
gagcacgaaagcgtcgccgcagccatcgaagatcactacaagccacaaggcccatcggat
cgcctgccggaagacaaggtggcgataaccgtggcgctggccgacaagctggatacgctg
gtttggttctgggcgattaatgagaagccgacagggtcgaaggacccgtttgcgctgcgg
cgggcggcgttgggcgatgtccgtattttgcttgagaagaatatacgtctgtccttgctt
gatgtttttgctcattcgttgctaggccgttcacttacgagcgaggagattgagcgaatt
attgatgccgctatttacgaaagtgttgcgggtggagcgcccaaagacagtacttcttca
aagtactcgcaggagtttgcgtcggtattcttgggcgggtctctcctctccttcttccac
gaccgtctgaaagtctatctgcgcgatcaaggcgcccgccatgacattatcgacgccgtg
ctgacgcctgaggccgacgacctgctgatggtcgcccgccgcgccgaagcactcaccgcc
ttcatcacctccgaagacggcaagaacctgttggcgggcaccaagcgcgctacgcagctg
ctggcggcggaggaaaagaagggaacggtggtggccgatggcgtgtccgaggcgctgctg
acactcgacgccgaaaaggcgctttacgccgccatcgtgcaagccacccaatccgcagcc
gaggccgtcgcaaaagaggatttccgctccgccatgcaggcgctttccaccctgcgcgcc
ccggtcgatacattcttcgaggatgtgttggtcaatgacgaggacgccgccatccgcgcc
aatcgcctggcgctgttgaaggccatccgcgaggcaaccggcacggtggcggatttctcc
aaaattgccgggtaa

DBGET integrated database retrieval system