KEGG   Agrobacterium vitis: Avi_1075Help
Entry
Avi_1075          CDS       T00851                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
avi  Agrobacterium vitis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Avi_1075 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avi_1075 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Avi_1075 (thrC)
Enzymes [BR:avi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Avi_1075 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(908511..909818)
Genome map
AA seq 435 aa AA seqDB search
MPREWPKMRKRDIRALRGKTYQEVAFAVLKPFVDGEIKDDALQAMIHDAYATFRHPAVAP
LVQTGPNSYILELFHGTTLAFKDVAMQLLGRLMDHVLRERGQRATIVGATSGDTGGAAID
AFAGLDNIDMFILFPKGKVSPVQQRQMTTSKAGNVRAVAIEGNFDDCQDLVKAMFNHVAF
RDKVQLSGVNSINWARIMAQVVYYFTAALSLGGPDRKISFTVPTGNFGDIFAGYVAREMG
LPIDKLVIATNDNDILARTLKTGRYEMRGVMATTSPSMDIQISSNFERLLFEASGRNAGE
IRSQMASLKQSGAFEIKPDALKTIRKLFRAGRATQQDVAKTIATTLAETGYLLDPHTACG
VVVASKFEKPQSPMVTLATAHPAKFPAAVKSASGIDPALPTWLADLMDREERFDVLAGEL
DVVEAFISAHSRAGA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ctgccccgcgaatggccgaaaatgcgcaagcgcgacattcgggcgctgcgcggcaagacc
tatcaggaggtcgcgtttgcggtgctgaaacccttcgtggacggcgaaatcaaggatgat
gcccttcaggcgatgatccatgacgcctatgccaccttccgccatcctgctgtcgcgcct
ttagtgcagaccgggccgaattcctatattctcgaactgttccacggcacgacgctggcc
ttcaaggatgttgccatgcaattgcttggccggctgatggatcacgttctgcgcgagcgc
ggacagcgcgccaccattgtcggcgccacctcgggcgatacaggcggggcggccatcgat
gcctttgccggtcttgataatatcgacatgttcattctgtttcccaagggcaaggtctca
cccgtgcagcagcggcagatgaccacatccaaggccgggaatgtccgggcggtggccatc
gagggcaatttcgacgattgccaggatctggtcaaagccatgttcaaccatgtcgctttt
cgcgacaaagtacagctatccggcgtcaattcgatcaactgggcgcgaatcatggcccag
gtggtctattactttaccgctgccctttcgctggggggaccggaccgcaaaatttccttc
accgtgccgaccggcaatttcggcgatattttcgcgggctatgtggcgcgcgaaatgggc
ctgcccatcgataagctggtgatagccaccaatgataacgacattctggcccgcacgctg
aaaaccggacgctacgagatgcgcggtgtgatggccaccacctcaccatcgatggatatc
cagatctcctcgaatttcgagcgcctgctgtttgaagccagcggccgcaatgccggtgag
atccgttcgcagatggcgtccctcaagcaatccggcgctttcgagatcaagccggatgcg
ctcaaaaccatccgcaaactcttccgggccgggcgcgccacccaacaggacgtggccaaa
accatcgccaccactttggctgaaaccggctatctgcttgatccccatacggcttgcggc
gtggtggtcgcatcgaaattcgaaaagccgcaaagcccgatggtgacgctggccacagct
catcccgccaaatttccggcggcggtaaaatcggcatcgggtattgaccccgcgcttccg
acgtggcttgctgatctcatggatagggaggagcgtttcgacgtccttgctggcgagctc
gacgtagtggaggcattcatctccgctcactcgcgcgccggtgcttaa

DBGET integrated database retrieval system