KEGG   Agrobacterium vitis S4: Avi_1490Help
Entry
Avi_1490          CDS       T00851                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
avi  Agrobacterium vitis S4
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:avi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:avi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1249308..1249871
Genome map
AA seq 187 aa AA seqDB search
MQFEETKLSGVFLITPKRFGDARGYFMETFRASLFESEVGSFTFVQDNKSFSAEVGTVRG
LHFQLNPRAQGKLVSCAAGALLDVAVDIRQGSPTYGQMVKAELTAENGCQLWVPPGFAHG
FCTLQPNTVISYKVTDYYSPDHDRGLLWNDPALAIDWPVTEDNAILSEKDKKQPKLSELE
TNFVYRP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgaagaaacgaagctgtcgggtgttttcctgatcactccaaagcggtttggg
gacgcgcggggctatttcatggaaaccttccgtgccagcctgtttgaaagcgaagtggga
tctttcaccttcgttcaggacaacaagtcgttttcggccgaggtcggcacggtgcgcggc
ctgcatttccagttgaacccgagggcgcagggcaagctcgtgtcttgtgcggctggcgct
ttgctggatgtcgctgtcgatattcgccagggctcgccgacctacggccagatggtcaaa
gccgaactgactgccgaaaacggctgccagctttgggtgccgccgggttttgcccatggc
ttctgcacattgcagcccaataccgtgatcagctacaaggtgacggattattacagcccg
gatcatgaccggggcctgttgtggaacgatccggctctggcgatcgactggccggtgacg
gaggacaatgccattctgtctgagaaggacaagaagcagccgaaactgagcgagcttgag
acgaatttcgtctatcggccttaa

DBGET integrated database retrieval system