KEGG   Agrobacterium vitis: Avi_1535Help
Entry
Avi_1535          CDS       T00851                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
avi  Agrobacterium vitis
Pathway
avi00230  Purine metabolism
avi01100  Metabolic pathways
Module
avi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Avi_1535 (gmk)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Avi_1535 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 ABC_tran AAA_18 AAA_29 AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACM36097
UniProt: B9JUV2
Position
1:1283782..1284444
Genome map
AA seq 220 aa AA seqDB search
MSIAASKNATIPRRGLMLVISSPSGAGKSTISRTLMDIDKQIGMSVSVTTRQRRPSEIEG
VHYHFISQREFERLKASDALLEWAEVHGNFYGTPREPVEVAMSEGRDMLFDIDWQGAQQL
QEKMAADVVSVFILPPTMTELQSRLHRRAEDSEEVIQTRLANSRSEIEHWREYDYVIVND
DLNSAFDAVQSIVKAERLRRDRRPGLFDFVNNLITEEPKL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgcagcgtccaaaaacgccaccattcccaggcgcggcctgatgctggtgatt
tcctcaccctcaggggcgggtaaatcgaccatttcacgcacgctgatggatatcgacaag
cagatcggcatgtcggtcagcgtcaccacgcgccagcgccgtccgagcgaaatcgagggc
gtgcattaccacttcatttcgcagcgtgagttcgagcggctcaaggcctcggatgcgctg
ctggaatgggcggaagtgcatggcaatttctatggtacaccacgcgagccggttgaggtg
gcgatgtcagagggacgcgacatgctgttcgacatcgactggcagggcgcccagcaattg
caagagaagatggccgccgatgtcgtctcggtcttcatcctgccgccgaccatgaccgag
ctgcaatcgcgcctgcaccgccgcgccgaggattccgaagaggtgatccagacgcggctg
gccaattcccgctccgagatcgagcattggcgtgaatatgactatgtcatcgtcaatgac
gatctgaattcggccttcgatgctgtgcagtcaatcgtcaaggccgagcgcctgcgccgc
gaccgccgcccgggcctgttcgatttcgtcaataacctgattacggaagagccaaagctt
taa

DBGET integrated database retrieval system