KEGG   Agrobacterium vitis: Avi_1546Help
Entry
Avi_1546          CDS       T00851                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
avi  Agrobacterium vitis
Pathway
avi00230  Purine metabolism
avi00240  Pyrimidine metabolism
avi01100  Metabolic pathways
avi03030  DNA replication
avi03430  Mismatch repair
avi03440  Homologous recombination
Module
avi_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Avi_1546
   00240 Pyrimidine metabolism
    Avi_1546
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Avi_1546
   03430 Mismatch repair
    Avi_1546
   03440 Homologous recombination
    Avi_1546
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Avi_1546
DNA replication proteins [BR:avi03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Avi_1546
DNA repair and recombination proteins [BR:avi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Avi_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ACM36107
UniProt: B9JUW2
Position
1:1296011..1296460
Genome map
AA seq 149 aa AA seqDB search
MTEVLFYHLTETRLEDALPALLEKSVERGWKVGVEMRDPERCDRLDQHLWTFRDDSFLAH
GISIGEQAEAQPILLCLSSDNPNGATVRFYIDGAVPDLPLVYDRIVFVFDGHDQGELETA
RGEWKRLKGEGHALTYWQQNNQGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaggtattgttctatcacctgaccgagacccggttggaggatgcgcttccggcg
cttttggaaaaaagcgtcgagcgcggctggaaggttggcgtagaaatgcgcgatccggag
cggtgtgaccggctggatcagcatttatggacctttcgcgacgacagttttctggcgcat
ggcatcagcatcggcgagcaggcggaggcgcaaccgatccttctctgcctgtcgtctgac
aatcccaatggggcgacggtgcgcttttatatcgacggtgctgtgccggacctgccgctt
gtctatgaccggatcgtcttcgtcttcgacggccatgatcagggcgagctggaaacggcg
agaggtgaatggaagcggctgaagggtgagggccacgcgctcacctattggcaacagaac
aaccaaggccgatgggaaaagaaggcttga

DBGET integrated database retrieval system