KEGG   Agrobacterium vitis S4: Avi_1762Help
Entry
Avi_1762          CDS       T00851                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
avi  Agrobacterium vitis S4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:avi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:avi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1474589..1475545)
Genome map
AA seq 318 aa AA seqDB search
MVFFPHRHLIGIKGLTETDITYLLDKADEAVKISRQREKKTSTLRGLTQINLFFEASTRT
QSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMHPDVLVVRHASAGAAALLS
QKVACAVINAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
AMGARVRVVAPATLLPSGIADMSVEVFHDMKEGLKDADVVMMLRLQRERMAGSFVPSIRE
YFHFYGLDAEKLKAAKEDALVMHPGPMNRGVEIASDVADGPQSVIESQVEMGVAVRMAVM
ESLLISDNNGPRSEGVGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtcttctttccccatcgccatctgattggcatcaagggccttaccgaaaccgatatt
acctatctgctcgataaagctgacgaagcggtaaaaatcagccgccagcgtgaaaaaaag
acctccaccctgcgcggtctgacccagatcaacctttttttcgaggcgtccacccgcacc
cagtcatccttcgagctggcgggcaagcggctcggtgccgatgtgatgaacatgtcggtc
ggtaattcgtcggtcaagaaaggcgagacgctgatcgatacggcgatgacgctgaacgcc
atgcacccggacgtgctggtggtgcgccatgcctcggccggtgccgcagcgcttctgtcg
caaaaggttgcctgcgcggtgatcaatgccggcgacggccagcatgaacatccaacccag
gcgctgctcgacgcgctgacaatccggcgcgccaagggcaagctgtcgcggatcatcgtt
gcaatctgcggcgacgtgctgcattcgcgcgtcgcccgctccaatattctcctgctcaac
gccatgggtgcgcgggtcagggtcgtggcccccgccacgctgctgccctctggcattgcc
gatatgagtgtcgaagtcttccacgatatgaaggaaggtctcaaggatgctgatgtcgtg
atgatgttgcgcttgcagcgcgagcgcatggcagggtcgtttgtcccgtcgatccgcgaa
tatttccacttctatgggcttgatgccgaaaagctgaaagccgccaaggaagacgccctg
gtcatgcatcccggcccgatgaaccggggggtggaaatcgcctccgatgtggccgatggg
ccgcaaagcgtcatcgaaagccaggtcgagatgggtgtcgccgtgcgcatggccgtgatg
gaatcgctactgatctctgacaataacggcccgcgtagcgaaggagttggcgcatga

DBGET integrated database retrieval system