KEGG   Agrobacterium vitis S4: Avi_1928Help
Entry
Avi_1928          CDS       T00851                                 

Gene name
glsA
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
avi  Agrobacterium vitis S4
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:avi00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:avi00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:avi00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1598175..1599101
Genome map
AA seq 308 aa AA seqDB search
MDLQAIVDDIVGEMQPRLGEGKVADYIPELATIDPKQFGIAITTVDGQTFTAGDAAIPFS
IQSISKVFMLTLALGKTGEGVWKRVGREPSGSSFNSIVQLEHEHGIPRNPFINAGAIVVT
DMVLAGHKPREAIGEFLRFMQFLADDDSITIDRKVAQSEQTTGYRNFALANFMSGFGNLH
HAVEMVLGVYFHQCALAMSCVQLSHAGLYLANRGTNPLSGFSVVSPKRARRINALMLTCG
HYDGSGDFAYHVGLPGKSGVGGGILAIAPGKASIAVWSPGLNKVGNSALGSEALELLATR
TGWSVFGN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcaggcaattgttgacgacattgtcggtgagatgcagccccggctcggggaa
ggcaaggtcgcggactatattcccgagcttgcgacgattgatccaaagcaattcggcatc
gccatcaccaccgtcgacggccagaccttcactgcgggcgatgcggcaattccattttcg
atccagagcatttccaaggtgttcatgctgacgctggcgcttggcaaaacgggggagggc
gtgtggaagcgggtcgggcgcgagccctccggctcgtccttcaactccatcgttcagctg
gagcatgagcatggcattccgcgcaaccccttcatcaatgcgggcgcaatcgttgtgacg
gatatggtgctggctggacacaagccgcgcgaggccatcggtgagttcctgcgctttatg
cagttcctggccgatgacgacagtatcaccattgaccgaaaggtggcgcagtctgagcag
acgactggctaccgtaatttcgcgctggccaatttcatgagcggttttggtaatctgcac
catgccgtggaaatggtgctgggtgtttatttccatcaatgcgcgctggcgatgagctgt
gtgcaactctcccatgcgggtctgtatcttgccaaccggggtacaaatccgcttagtggc
ttttccgtggtctcgccgaagcgggcgcggcgcatcaacgccttgatgctgacctgcggc
cattatgatggctcgggggattttgcctatcatgtcggcctgcccggcaagagcggtgtg
ggcggcggcatcctggcgatagcgccgggcaaggcctctattgcagtgtggtctccggga
ttgaacaaagttggcaattcggcgcttggatcggaagcgctcgaactgctggcaacccgg
accggctggtcggtttttggaaattga

DBGET integrated database retrieval system