KEGG   Agrobacterium vitis: Avi_2036Help
Entry
Avi_2036          CDS       T00851                                 

Definition
NADPH:quinone reductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
avi  Agrobacterium vitis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Avi_2036
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avi_2036
  Lipid metabolism
   00071 Fatty acid degradation
    Avi_2036
  Amino acid metabolism
   00350 Tyrosine metabolism
    Avi_2036
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Avi_2036
   00626 Naphthalene degradation
    Avi_2036
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Avi_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1670988..1672016
Genome map
AA seq 342 aa AA seqDB search
MRALQLIEDRKLEITDLPEPDAPGPGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVEAIGPGVGNILPGQLAAVYGARTCGLCKPCRDGRDNLCEHVGGVHGFHLDGFA
QEKINIPARLLVPAPPGVDAIAAALAPVTFGTVEHMLFDNAKLEPGETILVHAGGSGIGT
AAIQLAKKIGCTVITTVGSDDKIERARALGADHVINYRTDRFEGVVRKLTKKKGVDVVFE
HVGKDTWAGSMLCMKRGGRLVTCGSTSGVSTDLNLMMLFQQQLKLLGSFGCRMENMANAM
QKMARGLVHPVIDTQVTFEDIDVALTRMESRQIFGKIILKMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcattgcaattgatcgaagaccgtaagcttgaaatcaccgacctgccggagccg
gatgcgcccggtccgggtgaagtgacgctacgcgtcaaggcagtggcgctgaaccatatc
gatgtatggggctggcgtggcatggcctttgccaagcgcaagatgccgctggtgatcggt
gcggaagcctccggcgtggtcgaggctatcggccccggcgtcggcaatattctgcccggc
cagctggcggcggtctatggcgcgcgcacctgcggtctctgcaagccctgccgtgatggc
cgcgacaatctctgcgaacatgttggcggtgtgcatggcttccacctcgacggctttgct
caggaaaagatcaatattccggcccgtctgctggtgccggcacctccgggcgtcgatgcc
atcgccgcagcgcttgcgccagtcaccttcggcaccgttgaacacatgctattcgacaat
gccaagctcgagccgggtgaaaccattctcgtccatgctggcggctccggcatcggtact
gcggctatacagctggccaagaagatcggctgcaccgtgatcaccaccgtcggctcggac
gacaagattgaacgggcgcgggcgcttggcgccgatcatgtcatcaattaccgcacggac
cggtttgaaggcgtggtacgcaagctgaccaagaagaagggcgttgacgtggtgttcgaa
catgtcggcaaggatacctgggctggctccatgctgtgcatgaagcgcggcgggcgcctt
gtgacctgtggctcgacctccggcgtttcgaccgacctgaacctgatgatgttgttccag
caacaattgaaactgctcggctcgtttggctgccggatggaaaacatggccaatgccatg
cagaaaatggctcgcggcctcgttcatcctgttatcgatacgcaggtgacattcgaggac
atcgatgtggcgctgacccggatggaaagccgccagatctttggcaaaatcatcctgaaa
atggattga

DBGET integrated database retrieval system