KEGG   Agrobacterium vitis: Avi_2075Help
Entry
Avi_2075          CDS       T00851                                 

Definition
GGDEF protein
Orthology
K13590  
diguanylate cyclase
Organism
avi  Agrobacterium vitis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1700760..1701764)
Genome map
AA seq 334 aa AA seqDB search
MRSMGISPLPRNYELFYEAYIGSNPVLTRRVTALGSRATQDDLDRIAEEFFGHNSNRIIE
NAHSRLVSELDNLLRLMKQEQSSLETYNKLLDETCSRINAKSSGSVELLRNAIALLTRAT
DDTLAHGEKTAESFTQKSVEMDAVRRELDEYKRIANTDSLTRLANRRAFDERMAGLFNYP
STLTATSLMLIDIDHFKKINDTFGHPVGDKILATVAGVIRANAPRDAFVARAGGEEFAII
VEGMPDTEVFGLCERIRTNLENTLFRNSRTGVNYGPVTVSIGFALAANCQDPGELYSRSD
IALYCAKNAGRNCSRPFEPGMRKDFAKGWLIYKG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctatgggcatttcgccgctgccaagaaattacgagctgttctatgaggcctat
atcgggtccaacccggttctgacccgcagggtcaccgctcttggaagccgtgccacccag
gatgacctcgaccggattgccgaggaatttttcggccacaattccaaccgcatcatcgaa
aatgcccattcaaggctggtttcggaactggacaatctgctgcggctgatgaagcaggag
caaagttcgctcgagacctataacaagttgctggatgaaacctgttcgcgcatcaacgcc
aagagcagcggcagtgtcgagttgctgcgcaatgccatcgcactcctgacgcgggcaaca
gacgataccctggcccatggcgaaaagactgccgagagctttacccagaaatccgttgaa
atggatgccgtgcggcgtgaactggacgaatacaagcgaatcgccaacaccgattcgttg
acccggcttgccaatcgccgcgcctttgatgaacgcatggctggcctcttcaactatccc
tcgacactgacagcaacgtcgctcatgctgatcgatatcgaccatttcaagaagataaac
gatacattcggccatccggtcggcgacaagatcctggcgaccgttgcgggcgtcatccgt
gccaatgcaccgcgtgatgccttcgtggcacgggcgggtggtgaggaattcgccatcatc
gttgagggcatgccggataccgaagtgttcgggctgtgtgaacggatccgcaccaatctg
gaaaacaccctgtttcgcaactcccgcaccggcgtcaattacggtccggtcacggtctcc
atcggctttgccctggccgccaattgccaggaccccggcgaactttatagccgcagcgat
atcgccctgtactgcgcaaagaatgccgggcgcaattgcagcaggccgtttgaaccgggc
atgcgcaaggatttcgccaagggctggctgatctacaaggggtga

DBGET integrated database retrieval system