KEGG   Agrobacterium vitis: Avi_2075Help
Entry
Avi_2075          CDS       T00851                                 

Definition
(GenBank) GGDEF protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
avi  Agrobacterium vitis
Brite
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Avi_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1700760..1701764)
Genome map
AA seq 334 aa AA seqDB search
MRSMGISPLPRNYELFYEAYIGSNPVLTRRVTALGSRATQDDLDRIAEEFFGHNSNRIIE
NAHSRLVSELDNLLRLMKQEQSSLETYNKLLDETCSRINAKSSGSVELLRNAIALLTRAT
DDTLAHGEKTAESFTQKSVEMDAVRRELDEYKRIANTDSLTRLANRRAFDERMAGLFNYP
STLTATSLMLIDIDHFKKINDTFGHPVGDKILATVAGVIRANAPRDAFVARAGGEEFAII
VEGMPDTEVFGLCERIRTNLENTLFRNSRTGVNYGPVTVSIGFALAANCQDPGELYSRSD
IALYCAKNAGRNCSRPFEPGMRKDFAKGWLIYKG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctatgggcatttcgccgctgccaagaaattacgagctgttctatgaggcctat
atcgggtccaacccggttctgacccgcagggtcaccgctcttggaagccgtgccacccag
gatgacctcgaccggattgccgaggaatttttcggccacaattccaaccgcatcatcgaa
aatgcccattcaaggctggtttcggaactggacaatctgctgcggctgatgaagcaggag
caaagttcgctcgagacctataacaagttgctggatgaaacctgttcgcgcatcaacgcc
aagagcagcggcagtgtcgagttgctgcgcaatgccatcgcactcctgacgcgggcaaca
gacgataccctggcccatggcgaaaagactgccgagagctttacccagaaatccgttgaa
atggatgccgtgcggcgtgaactggacgaatacaagcgaatcgccaacaccgattcgttg
acccggcttgccaatcgccgcgcctttgatgaacgcatggctggcctcttcaactatccc
tcgacactgacagcaacgtcgctcatgctgatcgatatcgaccatttcaagaagataaac
gatacattcggccatccggtcggcgacaagatcctggcgaccgttgcgggcgtcatccgt
gccaatgcaccgcgtgatgccttcgtggcacgggcgggtggtgaggaattcgccatcatc
gttgagggcatgccggataccgaagtgttcgggctgtgtgaacggatccgcaccaatctg
gaaaacaccctgtttcgcaactcccgcaccggcgtcaattacggtccggtcacggtctcc
atcggctttgccctggccgccaattgccaggaccccggcgaactttatagccgcagcgat
atcgccctgtactgcgcaaagaatgccgggcgcaattgcagcaggccgtttgaaccgggc
atgcgcaaggatttcgccaagggctggctgatctacaaggggtga

DBGET integrated database retrieval system