KEGG   Agrobacterium vitis S4: Avi_2207Help
Entry
Avi_2207          CDS       T00851                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
avi  Agrobacterium vitis S4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1813227..1813832)
Genome map
AA seq 201 aa AA seqDB search
MDATVKKMSPETSRPSREEAENAVRTLLRWAGDDPSREGLLDTPKRVAKAYGELFGGYNV
NVEDVLGTTFEEVGGYNDIVLVRDIPFFSHCEHHMLPVIGKAHVAYLPNGRVLGLSKIAR
VVDLFARRLQTQETMTAQIADSLVQYLQPRGVAVMVDAEHMCMAMRGIQKSGSTTLTTTF
TGEFKTDVPQQVRFMTMVQNR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggatgccacagtgaaaaaaatgtcgcctgaaacgtcccgccccagccgcgaggaagcc
gaaaacgctgtgcgcacattgctgcgctgggctggcgatgatccgagccgggaaggcttg
ctcgacacgccaaagcgtgtggccaaagcttatggcgaactgttcggtggctataatgtc
aatgtcgaggacgtgctgggcacgacattcgaagaggttggcggctataacgacatcgtg
ctcgtgcgcgacatcccgtttttctctcattgcgagcatcacatgctacctgtcatcggc
aaggcgcatgtcgcttatctgccgaatggccgagtcctgggcctgtcgaaaatcgcccgc
gtcgtcgatctcttcgcccgccgcctgcaaacccaggaaaccatgacggcacagattgcc
gattctctcgttcagtatcttcagccacgcggcgttgccgtcatggttgatgcagaacat
atgtgcatggcaatgcgcggcattcagaaatccggctccacgacactgaccaccaccttt
accggtgagttcaaaaccgatgtccctcagcaggtgcggttcatgaccatggtgcaaaac
cgctga

DBGET integrated database retrieval system