KEGG   Agrobacterium vitis: Avi_2237Help
Entry
Avi_2237          CDS       T00851                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
avi  Agrobacterium vitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Avi_2237
Enzymes [BR:avi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Avi_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1837030..1837941
Genome map
AA seq 303 aa AA seqDB search
MNNGPSFLGFPERLSGGRKPEIVIVGAGHGSTYAGQDSGGHALPPDAIRVASQEDVGLID
HWDFDLGGPLFDNKPACCIDVGNVSTIMHDNLGNRTRIEAKTREILASSAVPVVLGGDDS
IPIPFVAGFSQHGPVWVLQIDAHIDWRDDKDGERYGYSSPMRRISEMPHVAGIVQVGMRG
VGSAGIAEIEAAQQYGSRIITSRTVHARGIEAVLQHIPEGAQTIITLDCDGLDPSVMPGV
AARTPGGLTYNQVIDLIAGIGKRGRIAGFDLVELYPPADIDNLSALTAARLVINVIGAIV
RQG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatggaccttcatttcttggctttcccgaacggctctccggcgggcgtaaaccc
gaaatagtgattgtcggcgctggtcatggcagtacctatgccggacaggatagcggcggt
catgccttgcctccagatgctatccgtgttgccagccaggaagatgtggggttgatcgac
cattgggatttcgatcttggtggcccgcttttcgataacaaaccggcttgctgcatcgat
gtcggtaatgtctcgacaatcatgcacgataatctcggcaaccgaaccagaatcgaggcg
aaaacacgggagatcttggcgtcttcggctgtaccagtcgtgttgggcggcgatgattcc
attccgattccatttgtcgctggcttttcgcagcacggacctgtttgggtcctgcaaatc
gatgcccacattgattggcgcgacgacaaagatggcgaacgatatggctattcgagcccg
atgcgccggatcagtgaaatgccgcatgttgccgggattgtgcaggttggcatgcgcggc
gtcggcagcgcaggtattgccgaaattgaggcggcgcagcagtatggcagtcggataata
acctctcgcacagttcacgctcggggtatcgaagctgtgctccagcacatcccggagggc
gcgcaaaccatcatcactctcgattgcgacggtcttgatccctcggtcatgccgggtgtg
gcggctcgaacgcctggcggtcttacatataaccaggtcatcgacctgatcgcggggatc
ggcaagcggggaagaattgccgggttcgatcttgtcgaactctatcctcccgcagacatt
gataacctctccgctttgaccgccgcacgtcttgtcatcaatgtcattggcgccatcgtt
cggcagggatga

DBGET integrated database retrieval system