KEGG   Agrobacterium vitis: Avi_2248Help
Entry
Avi_2248          CDS       T00851                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
avi  Agrobacterium vitis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Avi_2248 (folK)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Avi_2248 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1848466..1848966
Genome map
AA seq 166 aa AA seqDB search
MIAALGLGGNIGDPAHAMAAALKALDERPDCTVLAVSRLYSTPPWGKLDQADFFNSCALV
STTLPPSALLSVCLELERVMKRERRERWGPRTLDIDILLYGDQNIEEDHLSIPHPRMVQR
AFVLQPLCDIGSDLVVEGRSVADWLGQSDAHDIVVADTDPLWWKRG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcagcgctcgggctgggtggcaatatcggcgatcccgcgcatgccatggcagca
gcattgaaagccctggatgagcgcccggattgcacggtgttggcggtctcgcgcctttat
agcacgccgccctggggaaagctggatcaggcggatttcttcaatagctgcgcgctggtc
agcaccacattgccgccctccgcgctgctttctgtttgtctggagcttgagcgggtgatg
aaacgcgagcgtcgggagcgctggggcccgcgcacgctcgatatcgatattctgctctat
ggtgaccaaaatatcgaggaggatcacctgtcgatcccgcatccgcgcatggtgcagcga
gctttcgttcttcagccactctgcgatatcggcagcgaccttgtggtagagggccgatcg
gtggccgattggctggggcagtcggacgcccatgatatcgtcgtcgccgataccgatccg
ctttggtggaagaggggctaa

DBGET integrated database retrieval system