KEGG   Agrobacterium vitis S4: Avi_2473Help
Entry
Avi_2473          CDS       T00851                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
avi  Agrobacterium vitis S4
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:avi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2034782..2035837)
Genome map
AA seq 351 aa AA seqDB search
MAFDNEKLDALRRKYGGETGGEVFDPRFKRVAEKIFDSKGTRLAPYSGIPTFLSAPYRQV
EADNPDFGGLDVGIIGVPMDLGVTNRPGSRFGPRALRTIERIGPYNHVLDCAPVHELKVA
DVGDVPFASRYRLEQSHVDIEQRIGQMVTQGVVPLSVGGDHSITHPILKAVGKDRPVGLI
HIDAHCDTSGLFDQTKFHHGGPFRNAVLDGVLDPSRTVQIGIRGPAEYLWEFSYESGMTV
IHAEEISALGIPAVIAKALQVVGDGPTYLSFDIDSLDPAFAPGTGTPEVGGLTTREVLEL
LRGLKGVNLVGGDVVEVAPQYDSTTNTAQAGAQVLFEILSLMVFSPSIGKE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgacaatgaaaagctcgacgcgctgcgacgtaaatatggcggcgaaaccggc
ggggaagtgtttgatccccgcttcaagcgggtggctgaaaagatttttgacagtaaggga
acaaggcttgctccttattccggcattccgacgtttctctcggcgccctatcggcaggtc
gaggcggacaatccggattttggcggtttggacgtgggcattatcggcgtgccgatggat
ctgggcgtcaccaaccgccctggttcccgcttcgggccgcgtgccttgcgcaccatcgag
cggatcgggccgtataaccatgtgctggattgcgcgcctgtccatgaattgaaggtggct
gatgtcggtgatgtgccgtttgccagccgctatagattggaacagagccatgtcgatatt
gaacaacgtatcggtcagatggtgacacaaggagtggtgccgcttagcgtcggcggcgat
cactcaattacgcatccgatcctgaaggccgtcgggaaagaccgaccggtcgggcttatt
catatcgatgcccattgcgataccagcggcctgtttgatcagaccaagtttcaccatggc
ggcccatttcgaaatgcggtgctggatggtgtattggacccgtcgcgcacggtgcagatc
ggtattcgtggaccggcggaatatctttgggaattcagctatgaaagcggcatgacagtt
attcatgccgaagagatttcagcgcttggcattccagcggtgatcgccaaggctttgcag
gtggtcggggatggtccgacctatctgtcttttgatatcgacagtctcgatccggccttt
gcgccaggaactggcacgcccgaggtcggcggcttgaccacgcgcgaggtgctggaactg
ctgcgcggtctgaaaggtgtcaaccttgtcggtggcgatgttgtggaagtcgcgccgcaa
tatgacagcaccacaaatacggcgcaggcgggggcgcaggtgctgttcgaaatcctcagc
ctgatggttttcagtccgtccattggcaaggaatag

DBGET integrated database retrieval system